KEGG   Archaeoglobus veneficus: Arcve_1936
Entry
Arcve_1936        CDS       T01451                                 

Definition
(GenBank) Dihydrodipicolinate reductase
  KO
K00215  4-hydroxy-tetrahydrodipicolinate reductase [EC:1.17.1.8]
Organism
ave  Archaeoglobus veneficus
Pathway
ave00261  Monobactam biosynthesis
ave00300  Lysine biosynthesis
ave01100  Metabolic pathways
ave01110  Biosynthesis of secondary metabolites
ave01120  Microbial metabolism in diverse environments
ave01230  Biosynthesis of amino acids
Module
ave_M00527  Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ave00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Arcve_1936
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Arcve_1936
Enzymes [BR:ave01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.8  4-hydroxy-tetrahydrodipicolinate reductase
     Arcve_1936
SSDB
Motif
Pfam: DapB_C DapB_N CoA_binding Semialdhyde_dh Gp_dh_N 3Beta_HSD
Other DBs
NCBI-ProteinID: AEA47929
UniProt: F2KRR5
Position
complement(1721389..1722168)
AA seq 259 aa
MIRVAVAGAAGRMGRLIIKNVVEDKELELAQAFDVREVGKDAGELAGVGKTGVSVIHASE
MEEKLDADVLVDFTTASAAVENIRIASQKGVKLVVGTTGFTEEQKKQIEEYCKAVPAVVS
PNFSVGVNVFWKLLEAAASYLSNYDVEIVEIHHRFKRDAPSGTAVKAAEVIKSVIGEREV
VTGRSGECPRSDEIGVFAVRGGDVVGEHTVFFIGMGERVEITHRAWSRQAFAGGAIKAVK
WIAGINKPGIYGMADVLGL
NT seq 780 nt   +upstreamnt  +downstreamnt
atgatacgggttgcagttgccggggctgccggcaggatgggcaggctgataattaagaac
gttgttgaagacaaggagcttgagctggctcaagccttcgacgtgcgcgaagtaggaaaa
gatgctggcgagcttgcaggagttgggaagacaggcgtttccgtaatccacgcatctgaa
atggaggaaaagcttgacgcagatgtgctcgttgacttcacaactgcaagcgctgcagtg
gagaacataagaattgcatctcagaagggtgtaaagctcgtagttggtactactggattc
accgaggagcagaagaagcagatcgaagagtactgcaaggccgtgcctgcagtagtttcg
ccgaacttcagcgtgggtgtgaacgttttctggaaactcctcgaagctgcagcatcgtat
ctttcgaactacgatgttgaaatagtcgaaatccaccaccgcttcaagcgcgatgctccc
agcgggactgcagtaaaggctgcagaagtaataaaaagtgtcatcggcgaaagggaagtc
gttactggaaggagcggcgagtgtccacgtagcgacgagataggtgtctttgcagtcaga
ggtggcgatgtggtcggagagcacacggtattctttataggcatgggtgaaagggttgag
atcactcatagagcgtggagcaggcaggcgtttgctggaggagcgataaaggccgttaag
tggatagccggcatcaacaaacccggaatctacggaatggccgatgttcttggtctatga

DBGET integrated database retrieval system