KEGG   Archaeoglobus veneficus: Arcve_1937
Entry
Arcve_1937        CDS       T01451                                 

Definition
(GenBank) Dihydrodipicolinate synthase
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
ave  Archaeoglobus veneficus
Pathway
ave00261  Monobactam biosynthesis
ave00300  Lysine biosynthesis
ave01100  Metabolic pathways
ave01110  Biosynthesis of secondary metabolites
ave01120  Microbial metabolism in diverse environments
ave01230  Biosynthesis of amino acids
Module
ave_M00527  Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ave00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Arcve_1937
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Arcve_1937
Enzymes [BR:ave01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.7  4-hydroxy-tetrahydrodipicolinate synthase
     Arcve_1937
SSDB
Motif
Pfam: DHDPS ELFV_dehydrog
Other DBs
NCBI-ProteinID: AEA47930
UniProt: F2KRR6
Position
complement(1722165..1723031)
AA seq 288 aa
MFEGVIPALVTPFKENFEVDYEGIAKNLDFLEKHVDAVVPAGTTGEAATLSYEEHIEVVR
YVAEVSNVPVIGGAGSNSTKEAIFLAKEVEKAGANAAMLVTPYYNKPNPEGLYEHYKTVA
SEVSIPIIVYNVPSRTACNITPEVAEKLSQIENIIGIKEASGNLKQIAEIIRRTPDDFVL
LSGDDFLTLPVLLLGGKGVISVAANVAPQLMKEMYLAFKNGDVAKARELHYKLMPLFSAL
FIDTNPIPVKKAMELMGLAAGKPRLPLVELNEEKTAKLKDVLVSLGLL
NT seq 867 nt   +upstreamnt  +downstreamnt
atgtttgagggcgtaattccagctcttgtcacgcccttcaaggaaaacttcgaggtagat
tacgagggcatcgcgaagaacctcgacttccttgagaagcacgttgatgcagttgttcca
gcaggaacgacaggtgaggcggcaacgctgagctacgaggagcacatcgaagtggttcgc
tacgttgccgaagtctcgaatgttccggttattggtggagctggctcaaactcgacaaag
gaggcgatatttctcgcaaaggaagttgagaaggccggagccaacgcagcaatgcttgta
acgccatactacaacaagccgaatccggaagggctgtatgagcactataaaactgttgca
agcgaggtttccatcccgataatcgtctacaacgttccaagcaggactgcctgcaacata
acgcctgaagtggcggaaaagctctcgcagattgagaacataattgggataaaagaggcg
agtggaaacctcaagcagatagcggaaataataaggcgaacgccggatgattttgtttta
ctctcaggagacgattttctgacgctacccgtactgcttcttggcgggaagggcgtgata
agtgttgccgcaaacgttgctcctcagctaatgaaggagatgtacctcgcttttaagaac
ggagatgttgcgaaggcgagggagcttcattacaagctcatgccccttttcagcgctcta
ttcatcgataccaatcctatacccgtaaagaaggccatggaactcatggggcttgctgcc
ggaaagccgaggctgcccttagtggaactgaatgaagagaaaacagcaaagcttaaggac
gttctcgtttcccttgggttgctatga

DBGET integrated database retrieval system