KEGG   Archaeoglobus veneficus: Arcve_1983
Entry
Arcve_1983        CDS       T01451                                 

Definition
(GenBank) Acetylornithine/succinyldiaminopimelate aminotransferase
  KO
K00821  acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17]
Organism
ave  Archaeoglobus veneficus
Pathway
ave00220  Arginine biosynthesis
ave00300  Lysine biosynthesis
ave01100  Metabolic pathways
ave01110  Biosynthesis of secondary metabolites
ave01120  Microbial metabolism in diverse environments
ave01210  2-Oxocarboxylic acid metabolism
ave01230  Biosynthesis of amino acids
Module
ave_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:ave00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Arcve_1983
   00220 Arginine biosynthesis
    Arcve_1983
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ave01007]
    Arcve_1983
Enzymes [BR:ave01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.11  acetylornithine transaminase
     Arcve_1983
    2.6.1.17  succinyldiaminopimelate transaminase
     Arcve_1983
Amino acid related enzymes [BR:ave01007]
 Aminotransferase (transaminase)
  Class III
   Arcve_1983
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase Aminotran_5
Other DBs
NCBI-ProteinID: AEA47976
UniProt: F2KS37
Position
1761061..1762203
AA seq 380 aa
MKEWFERERAVHIQFYRRQPVVFVKGEGCYLYDVEGKKYLDMVAGIAAATLGHCHPKFIA
RVSEQLKKLVHVSNLYYTTPQIELAEKLREITGMDRFFFCNSGAEAVEASLKIARKATGR
KKFVAFSGSFHGRTMGALSVTWKEKFRRPFEPLVQPVEFAEFNSVEDLEKKVDEETAAVI
LEPVQGEAGVYPATKEFINELFRLRDEYNFLVIFDEVQTGFGRTGRWFAKEHYGVKPDIM
AMAKAMGSGFPIGGVGVSEEVAEKLEAGEHASTFGGNPLACVASLATIEIIEEEKLVENS
EKTGKYLRKRLEELDGIKEVRGMGLMIGAKVENAPGMVSRSLEKGLLVNATSENALRFVP
PLIAGREEIDFAVDILSSLK
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgaaagaatggtttgaaagggaaagagccgttcacattcagttttaccgccgtcagccc
gtggtatttgtaaaaggcgaaggttgctacctttacgatgttgaaggaaagaagtatctc
gacatggttgctggcatagccgctgctacgttagggcactgtcacccgaaattcattgca
agagtttcagaacagttaaaaaagctcgttcacgtctccaacctctactacacaaccccg
cagatagagcttgcagagaagctgagggagattacagggatggacaggttcttcttctgc
aacagcggggctgaggcagttgaagcatcgctcaagattgcgaggaaagcaactggcaga
aagaagttcgtcgcattcagcggctcattccatggccgtacgatgggtgctctctcagta
acatggaaggagaagtttagaaggccctttgagcctctcgttcagccggtagagtttgca
gaattcaacagcgttgaggaccttgaaaagaaagttgatgaagagactgccgcagttatt
ctcgagccagtgcagggagaggcgggagtatatccggcaaccaaggaatttatcaatgag
cttttcaggctccgcgacgagtataactttctcgttatattcgacgaagttcagacggga
tttggaaggactggcaggtggttcgcaaaggagcactacggcgtaaagcctgacatcatg
gcaatggcgaaggctatgggctcaggtttccccattggaggtgtcggcgttagcgaggaa
gtagcggagaagctcgaagctggagagcacgcttcaaccttcggcggcaatccactcgca
tgcgttgcatcgcttgctacgatagaaataatagaagaggaaaagctcgttgagaactca
gaaaaaacaggtaaatatctacgtaaaaggctcgaagaacttgatggcatcaaggaagtc
agaggcatgggactgatgattggtgcaaaagttgaaaatgctccgggcatggtgtcgagg
agtcttgaaaagggtttgctcgtcaacgcaacgtcagaaaatgctctcaggttcgtgccg
ccactgatagcgggtagagaagagattgattttgctgtagacatactgtcgtccctgaag
taa

DBGET integrated database retrieval system