KEGG   Archaeoglobus veneficus: Arcve_2097
Entry
Arcve_2097        CDS       T01451                                 

Definition
(GenBank) LL-diaminopimelate aminotransferase
  KO
K10206  LL-diaminopimelate aminotransferase [EC:2.6.1.83]
Organism
ave  Archaeoglobus veneficus
Pathway
ave00300  Lysine biosynthesis
ave01100  Metabolic pathways
ave01110  Biosynthesis of secondary metabolites
ave01230  Biosynthesis of amino acids
Module
ave_M00527  Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ave00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Arcve_2097
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ave01007]
    Arcve_2097
Enzymes [BR:ave01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.83  LL-diaminopimelate aminotransferase
     Arcve_2097
Amino acid related enzymes [BR:ave01007]
 Aminotransferase (transaminase)
  Class I
   Arcve_2097
SSDB
Motif
Pfam: Aminotran_1_2 ALF
Other DBs
NCBI-ProteinID: AEA48086
UniProt: F2KSL6
Position
1853375..1854529
AA seq 384 aa
MFGLAERLQRLPPYLFAELDAMKRKKLREGVKLIDFGVGDPDLPTPPHIVEAMKKAVEKV
ENQKYPSYEGMLSFREAVADFYKRRKGVDLDPEKEVIALIGSKEGIAHLPLAYVNSGDIV
LCPDPGYPVYPSSAILADGKPYFMPLKKENGFLPDLQAIPDDVARKAKIMFLNYPNNPTA
SVAEKDFIKEVIEFCNDRKIVLAHDAAYSEITFDYRARSFLEVGIEGVIEFNSLSKTYNM
TGWRIGFAAGCPEVLAGLLKVKTNVDSGVFQAVQEAAIAALTGSDEVIDENNRIYKERRD
TLIEGLKEVGLNAEKPKATFYVWCEVPEGYTSMEFTKKLLNDAGILVTPGIGFGEHGEGF
VRFALTRDVGVIQEAVERLKGLSL
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgttcggtctggcggagaggcttcaaaggctaccaccatacctgtttgcagaattagac
gcaatgaagaggaagaaactgagggagggcgtgaagctaatagacttcggtgttggcgat
ccagacttaccaacgccaccacacatcgttgaggcgatgaagaaggcagttgaaaaggtg
gagaaccagaagtaccccagctacgaagggatgctgtccttcagggaggctgtagcggac
ttctataagagaagaaaaggtgtagacctcgacccagagaaggaagtcatagccctcatc
ggctcgaaggaaggtatagcacacttaccgcttgcatacgtcaacagtggagatatcgtt
ctctgtcccgacccgggatatcccgtttatccatcctccgccatcctcgccgacggaaag
ccttatttcatgccacttaagaaggaaaacggcttccttccagacttgcaggcaatcccc
gacgacgttgcaaggaaggcgaagataatgttcctgaactaccccaacaaccccaccgca
agcgttgcggagaaggacttcataaaggaagtcatcgagttctgcaacgacaggaaaatc
gtacttgcccacgatgcagcgtacagcgagattaccttcgattacagagcaagaagtttc
ctcgaagttggtattgaaggtgtcatagaattcaactccctctccaagacctacaacatg
acgggctggcgtatcggatttgctgcaggctgccccgaggtccttgccggcctgctcaag
gtgaaaaccaacgttgacagtggagtatttcaggctgtgcaggaggctgcgattgctgct
cttacgggaagcgacgaagtcatagatgaaaacaacagaatttacaaggagagaagagat
accctcatcgaagggttgaaagaagtaggcctcaacgccgagaagccgaaggcgacgttt
tacgtctggtgcgaggttcctgaaggctatacgagcatggagttcacaaagaagttgctg
aacgatgcaggcatcctcgtaacacctggtatcggtttcggtgagcacggcgagggattc
gtcaggttcgcccttacgagagatgttggagttattcaggaagcagttgagaggctcaag
ggcctgagtctgtaa

DBGET integrated database retrieval system