KEGG   Archaeoglobus veneficus: Arcve_2098
Entry
Arcve_2098        CDS       T01451                                 

Definition
(GenBank) diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Organism
ave  Archaeoglobus veneficus
Pathway
ave00300  Lysine biosynthesis
ave01100  Metabolic pathways
ave01110  Biosynthesis of secondary metabolites
ave01120  Microbial metabolism in diverse environments
ave01230  Biosynthesis of amino acids
Module
ave_M00527  Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ave00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Arcve_2098
Enzymes [BR:ave01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.20  diaminopimelate decarboxylase
     Arcve_2098
SSDB
Motif
Pfam: Orn_Arg_deC_N Orn_DAP_Arg_deC Ala_racemase_N
Other DBs
NCBI-ProteinID: AEA48087
UniProt: F2KSL7
Position
1854529..1855812
AA seq 427 aa
MPGCGSMFRSVDGVLHVEGVSVLDLVKELGSPLYVTSRGRLEENMKAYMQAFPDARLLYA
VKANNNLSIMKIISRAGFGADVFSDGELYLALLAGFKPEKILFNGNSKSEEEIRMGVRAG
TYFSVDSIDELHVLSEVAVEEGEEVKIAFRINPDISPETHPKISTGLRTSKFGIPWEEVA
NAYRLAVEMPGIVPAGIHCHIGSQILDISPFVEALNRLFDVAEVLEDMGIDVEFLDLGGG
LGIDYEGKGSPTPADFAAKILPVFEERKERLNSNPELWLEPGRSIIGNTTILLTKVNAVK
KAYKNFVAVDAGFNLLMRPAMYNAYHRVAIANKMDREEEEVYTIVGPICESGDVLAEDRK
LPRVERGDIIAIFDAGAYGFSMSSQYNGRRRCAEVLVEGNKYYVIRERESYTDLVGKQVI
PEHLLKE
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgcctggctgtggtagcatgttcagaagcgttgatggagtcctccacgtcgaaggggtt
agcgttctcgatcttgtcaaggagcttggctcgccgctatacgtcacctcgagaggtagg
ctcgaggaaaacatgaaagcatacatgcaagcgtttcccgacgcaaggctgctgtatgct
gttaaagccaacaacaacctctcaataatgaagataatttcgagagcgggatttggagcg
gacgttttcagcgatggagagctttatttagcacttcttgccggctttaagccggaaaag
attctcttcaacggaaattcgaaaagtgaagaggaaatccgaatgggcgtcagggcaggc
acgtacttcagcgttgacagcatcgacgaactccacgttctgtcagaagtggcggttgag
gagggcgaggaggttaagattgcgttcaggataaaccccgatatatctccggagacacat
ccgaaaatatctaccggcctcagaacgtcaaagtttgggattccgtgggaggaagttgcg
aacgcctacaggcttgctgttgaaatgcccggcattgtgcctgcaggcatccactgccac
ataggaagccagattctcgacatttcgcccttcgtggaggcgttaaaccgccttttcgac
gttgcagaagtgctcgaggatatgggaatagatgtagaattcctcgatctcggcggtggc
ctgggaatagactacgaggggaaaggatctccaactccagccgatttcgcagcaaagatt
ctacccgttttcgaggagaggaaagaaaggctgaactcgaatccggagctgtggctcgaa
cccgggaggagcataataggcaacactacaatactgctgacgaaagtgaatgctgtaaag
aaggcctacaagaacttcgttgcggtcgatgcaggttttaatctgcttatgaggccagca
atgtataatgcctatcacagagtagccatagccaataaaatggatcgcgaagaggaagaa
gtatacaccatagtgggcccaatatgcgagagcggagatgttcttgctgaggatagaaaa
ctgccaagggttgagagaggggacattatagctatattcgacgcgggagcttacggcttc
tcaatgagcagccagtacaacggaaggcgaagatgcgctgaagtcctcgttgaaggcaat
aagtactacgtcataagggaaagagagagctacaccgatctggttggaaaacaagtaatt
ccggagcaccttttgaaagaataa

DBGET integrated database retrieval system