KEGG   Agrobacterium vitis: Avi_0543Help
Entry
Avi_0543          CDS       T00851                                 

Gene name
apaG
Definition
(GenBank) apaG protein
  KO
K06195  ApaG protein
Organism
avi  Agrobacterium vitis
Brite
KEGG Orthology (KO) [BR:avi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Avi_0543 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ACM35386
UniProt: B9JQX3
Position
1:complement(461939..462331)
Genome map
AA seq 130 aa AA seqDB search
MYRALTRDIEVTVEPFYLAEQSDPEDSRYVWGYRVVIVNQSNVAVRLINRYWHITDQNGQ
VDEVSGPGVIGEQPRLAPGESFEYSSGCPLDTPSGIMFGRYEMETDDAETFDVAIPAFSL
DTPDLRRVLN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgcgcgctgacacgggatatagaggtcacagtcgagccattttacctggcggaa
cagtccgacccggaagacagtcgttatgtctggggctacagggtcgtcattgtcaatcag
tcgaatgtggccgtgcggctgatcaatcgttactggcatattacggatcagaatggccag
gtggacgaggttagcggtccgggcgtgatcggcgaacagccacgcctggctccgggtgaa
agttttgaatattcgtcaggctgtccattggacacgccatccggtatcatgttcggccgc
tacgaaatggaaactgacgatgccgaaacattcgacgtcgccattcccgccttttctctg
gacaccccggatcttcgccgcgtcctgaactga

DBGET integrated database retrieval system