KEGG   Agrobacterium vitis: Avi_0567
Entry
Avi_0567          CDS       T00851                                 

Definition
(GenBank) secretion protein HlyD family
  KO
K11003  hemolysin D
Organism
avi  Agrobacterium vitis
Pathway
avi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:avi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Avi_0567
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:avi02000]
    Avi_0567
   02044 Secretion system [BR:avi02044]
    Avi_0567
Transporters [BR:avi02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   Avi_0567
Secretion system [BR:avi02044]
 Type I secretion system
  alpha-Hemolysin/cyclolysin transporter
   Avi_0567
SSDB
Motif
Pfam: HlyD_3 HlyD HlyD_D23 Biotin_lipoyl_2 DUF641 Biotin_lipoyl DUF749 RnfC_N GvpO DUF5339 Kre28 AAA_23
Other DBs
NCBI-ProteinID: ACM35403
UniProt: B9JQZ0
Position
1:complement(479498..480973)
AA seq 491 aa
MNVSLKRSQGAVTLLRRTDKPVRTDQEFLAPALEILETPPSPVRMALVVIIAALFAVAIT
WAAVGKIDIVATAQGKIEPTLKVKIVQPLATGKVSDVLVQNGDHVSKDQVLVRLDDSSAA
SQYDDLSEQLAASRAEVARRSAAIETVSSRNWPVGGATQINVAWPEGISVALQRREQSVL
DSDVAQLSAQLSLIDSQIAQKTIDSDAFGATVSAQESLISTLKKLTFMRETLSQNNAMST
ADWLNALQEEEKEQVSLQSDINEKLDADANIAVLKRQAVSTTQSFIADYAQKLEAADEQV
QELTQQLREAKAQLDDMTLRSPVDGTIEASTLTSIGQVLTSGSEVLRVVPEGSHLDIQAY
ITNDEIGFVQVGQAATIKVTAFPYTQYGTISGTVLQVGKDAVSTSQAQADLADSSYTMTT
TASGSTSQSADTLVFPVIVQLDKNFIGTAERSAYVSPGMSVSVDINTGDRTILDYLFAPL
VDVTSSALHER
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgaatgtttcgctcaagcgatctcaaggagcagtcacgctgctgcgcagaaccgataaa
ccagtcaggacggaccaggaatttcttgcgccggctctcgagatcttggagaccccgccc
tcgcctgtgagaatggcgcttgtcgtgatcatcgccgctttgtttgcggtcgccatcact
tgggcagcggttggtaaaatcgatattgtcgcaacggctcaaggcaaaatcgagccaacg
cttaaggtaaagatcgttcaacctctggccaccggtaaagtgtccgacgttctggtgcaa
aatggcgaccacgtctccaaggaccaagttctcgtgcgtctggatgactcgtcggctgca
tctcagtatgatgatttgtcggagcaactggccgccagcagagccgaagtcgctcgacgt
agtgccgctattgagactgtttcgtcacggaactggccggttgggggagcgacacaaatc
aatgttgcctggcccgaaggaatatcggttgcgttgcaacgccgggaacaaagcgtcctt
gacagcgacgtcgcgcaactgtccgcacaactctcactcatcgatagtcaaatcgctcag
aagacgatcgattccgatgcgttcggagcgacagtttcggcacaggagagcctaatctca
acactaaagaagctgacatttatgcgcgagacgctgtctcagaacaacgccatgtcgact
gcggattggctgaacgctttgcaagaagaagagaaggaacaggtttccttgcaaagcgac
atcaatgaaaagcttgatgccgacgcaaacatcgcagtcctcaagcgacaagccgtatcg
acgacccaatcattcatcgccgattacgcccagaagctagaagcagcggacgaacaggta
caggaactgacacagcagttgcgtgaagccaaggcccaactcgatgatatgacgttgcgt
agcccggtcgatggtacgattgaagcatcgacactcacatcgatcgggcaggtgctgacc
agcggatcagaggtgttgcgcgttgttcccgagggaagccatctcgatattcaagcatac
atcaccaatgatgagatcgggttcgttcaggtcggacaagcagcgaccatcaaggtaact
gcgttcccttatacgcagtacggcacgatcagtggaactgtccttcaggttggcaaggat
gccgtatcgacctctcaagcccaagcggatctcgcagattcctcctatacaatgaccacg
acggcatcagggagcacgtctcaatccgcggatacgcttgtatttcccgtcatcgtccag
ttggacaagaatttcatcggaaccgcagagcgcagcgcctacgtgtcgcctggcatgtcg
gtgtcagtcgacatcaatacaggtgacaggactattctcgattatcttttcgcgcccctt
gtcgatgtcacaagctcggccctgcacgaacgctga

DBGET integrated database retrieval system