KEGG   Agrobacterium vitis: Avi_0598Help
Entry
Avi_0598          CDS       T00851                                 

Definition
(GenBank) acyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
avi  Agrobacterium vitis
Pathway
avi00071  Fatty acid degradation
avi00072  Synthesis and degradation of ketone bodies
avi00280  Valine, leucine and isoleucine degradation
avi00310  Lysine degradation
avi00362  Benzoate degradation
avi00380  Tryptophan metabolism
avi00620  Pyruvate metabolism
avi00630  Glyoxylate and dicarboxylate metabolism
avi00640  Propanoate metabolism
avi00650  Butanoate metabolism
avi00900  Terpenoid backbone biosynthesis
avi01100  Metabolic pathways
avi01110  Biosynthesis of secondary metabolites
avi01120  Microbial metabolism in diverse environments
avi01130  Biosynthesis of antibiotics
avi01200  Carbon metabolism
avi01212  Fatty acid metabolism
avi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:avi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Avi_0598
   00630 Glyoxylate and dicarboxylate metabolism
    Avi_0598
   00640 Propanoate metabolism
    Avi_0598
   00650 Butanoate metabolism
    Avi_0598
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Avi_0598
   00072 Synthesis and degradation of ketone bodies
    Avi_0598
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Avi_0598
   00310 Lysine degradation
    Avi_0598
   00380 Tryptophan metabolism
    Avi_0598
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Avi_0598
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Avi_0598
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Avi_0598
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:avi04147]
    Avi_0598
Enzymes [BR:avi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Avi_0598
Exosome [BR:avi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Avi_0598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACM35425
UniProt: B9JR12
Position
1:complement(512123..513331)
Genome map
AA seq 402 aa AA seqDB search
MTEVYVYDHVRTPRGRGKKDGALHEVPSVRLAAKALEAIRDRNGLDTSTVDDIIMGCVDP
VMDAGAVIPKAAAFEAGYSTKAPGIQISRFCASGLDAINLAAGKIATGADDIVIAGGVES
MSRVGLGMSGGAWFMDPSVNFPAFFMPQGVSADLIATKYGFSRDDVDAYAVESQKRSANS
WANGYFDKSVVAVKDQNGLTILDRDEHMRPGTDMQSLAGLNPSFQMPGEMGGFEAVGIQA
HPEIEKINYVHHAGNSSGIVDGSGVVLLGSKTGGESMGLKPRARIRAFANIGSDPALMLT
GPVDVTEKLLKKTGMTLADIDLFELNEAFAAVVLRFMQHFDVSHDVMNVNGGAIAMGHPL
GATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATVIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagtctatgtttacgaccacgtgcgcacgccgcgcggccgcggcaagaaggat
ggcgcactgcatgaagtgccatccgtgcgcctggccgccaaggcgctggaagccatccgc
gaccgcaacggtctcgacacatccaccgtcgatgacatcatcatgggttgcgtcgatcct
gtcatggatgctggcgcggtgatccccaaggctgcggcctttgaggccggttattccacc
aaggctccgggcatacagatctcgcgtttctgcgcgtctggtcttgatgccatcaatctg
gccgcaggcaagattgccacgggtgcggatgatatcgtcattgccggtggcgtggagagc
atgtcacgtgttggccttggcatgtcgggtggggcgtggttcatggacccatccgtcaac
ttcccggcttttttcatgccgcagggcgtgtccgccgatctgatcgccacaaagtatggc
ttttcccgcgatgatgtggatgcctatgcggtggaaagccagaaacgctccgccaattcc
tgggcaaatggctatttcgacaaatcggtcgtcgccgtgaaggaccagaacggcctgacc
attctggaccgcgacgaacatatgcgccccggtactgacatgcagtcgctggcgggtctc
aacccttccttccagatgcccggtgaaatgggcggctttgaagccgtcggcattcaggcg
catcccgagattgagaaaatcaattacgtccaccatgcgggcaattcgtccggtattgtg
gatggctccggcgttgtgctgctcggctccaagaccggcggcgagagcatgggattgaag
ccccgcgcccgcattcgcgcctttgccaatatcggctccgatccggccttgatgctgacc
ggccctgtcgatgtgacggaaaagctgttgaagaaaaccggcatgacgctggccgacatc
gatctgttcgagctgaacgaagcctttgccgccgtggttctgcgcttcatgcagcatttt
gacgtgtcccatgatgtcatgaacgtcaatggcggcgcgattgccatgggccacccgctg
ggtgctaccggcgcgatgatcctcggcaccgtgctggatgagctggagcggcgcgacctg
aacaccgcactggtgacgctctgcatcggggctggcatgggcaccgctaccgttattgaa
cgagtctga

DBGET integrated database retrieval system