KEGG   Agrobacterium vitis: Avi_0798Help
Entry
Avi_0798          CDS       T00851                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
avi  Agrobacterium vitis
Pathway
avi00030  Pentose phosphate pathway
avi00480  Glutathione metabolism
avi01100  Metabolic pathways
avi01110  Biosynthesis of secondary metabolites
avi01120  Microbial metabolism in diverse environments
avi01130  Biosynthesis of antibiotics
avi01200  Carbon metabolism
Module
avi_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
avi_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
avi_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:avi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Avi_0798 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Avi_0798 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:avi04147]
    Avi_0798 (zwf)
Enzymes [BR:avi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Avi_0798 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Avi_0798 (zwf)
Exosome [BR:avi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Avi_0798 (zwf)
  Exosomal proteins of colorectal cancer cells
   Avi_0798 (zwf)
  Exosomal proteins of bladder cancer cells
   Avi_0798 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ACM35567
UniProt: B9JRU1
Position
1:complement(683930..685399)
Genome map
AA seq 489 aa AA seqDB search
MSSQIIPVEPFDYVVFGGTGDLAERKLLPALYHRQLAGQLTEPTRIIGASRSPMTDAEYR
EFAHKALKEFLKEDELEESQVKRFLDRLHYVSVDAKDDKGWDTLKKLLDTGKDIVRAFYL
AVSPSIFGDIADKIRDHKLITKSTRIVVEKPIGRDLASAQALNDTIGKVFKEEQIFRIDH
YLGKETVQNLMALRFANALYEPLWNSAHIDHVQITVAESVGLEGRVTYYDKAGALRDMVQ
NHILQLLCLVAMEAPSSMNSEALRDEKLKVLRALKPIDASNVEKMTVRGQYKAGASAGGA
VKGYTEELGDSSDTETFVAIKAEINNWRWAGVPFYLRTGKRLAGRVSEIVIQFKPIPHSI
FGDVGRIEANQLVIRLQPDEGVKQWLMIKDPGPGGMRLRHVPLDMSFAESFGVRNPDAYE
RLLMDVIRSNQTLFMRRDEVEAAWNWVDPILKSWEEIGQRAQGYTSGTWGPSQAIALIER
DGRTWHEND
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccagattattcctgtcgaaccctttgactatgtcgtctttggcggcaccggg
gatcttgccgagcgcaagcttctgccggccctttatcaccgccagttggccggccagctc
acagagccgacccggatcatcggggcgtcccgctcgccgatgacggatgcggaataccgt
gaattcgcccataaggccctgaaagaattcctgaaagaagacgaattggaagaaagccag
gtcaagcgctttctcgaccggctgcattatgtgtctgtcgatgccaaggacgacaagggc
tgggacacgctgaaaaagctgctggacaccggcaaggacatcgtgcgcgccttctatctc
gctgtgtctccgtcgattttcggcgatatcgccgacaagatccgcgatcacaagctgatc
accaaatccacccgcatcgtggtggaaaagccgattggccgcgatctggcctcggcgcag
gcgctgaacgacaccattggcaaggtgttcaaggaagagcagatcttccgcatcgaccat
tatctcggcaaggaaaccgtgcagaacctaatggcgctgcgctttgccaatgcgctctat
gagccgctgtggaattccgcccatatcgaccatgtgcagatcaccgtggccgaatccgtc
gggctggaaggccgtgtcacctattacgacaaggcgggcgcgctgcgtgacatggtgcag
aaccatatcctgcaattgctttgcctcgttgccatggaagccccatcctcgatgaactca
gaggcgctgcgtgatgaaaagctgaaagtgctgcgggcactgaagccaatcgacgcctcc
aatgttgaaaaaatgaccgttcgcggccagtacaaggccggtgcttcggcgggtggcgcg
gtgaagggctacacggaagagttgggcgatagttccgacacggaaaccttcgtcgccatc
aaggccgagatcaataattggcgctgggcgggcgtgccgttctatctgcgcaccggcaag
cgtctggcaggccgcgtttcggaaatcgtcatccagttcaagccgatcccccattcgatc
ttcggcgatgtcggtcgcatcgaggccaaccagctggttatccgcctgcaaccggacgaa
ggcgtcaagcaatggttgatgatcaaggatccaggtccgggcggcatgcgtctgcgccat
gtaccgctggatatgagctttgccgaatccttcggcgtgcgcaatcccgatgcctatgag
cgcctgttgatggacgtgatccgttccaaccagacgctgttcatgcgccgcgacgaagtg
gaagcggcctggaactgggtcgatccgatcctgaagagctgggaagaaattggtcagcgg
gcgcagggctatacatcgggcacctggggaccaagccaggccatcgcgctgatcgagcgt
gacggtcgcacttggcacgagaatgactga

DBGET integrated database retrieval system