KEGG   Agrobacterium vitis: Avi_1088Help
Entry
Avi_1088          CDS       T00851                                 

Definition
(GenBank) conserved hypothetical protein
Organism
avi  Agrobacterium vitis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_41 TPR_2 TPR_14 zf-RING_UBOX TPR_7 SRP_TPR_like
Motif
Other DBs
NCBI-ProteinID: ACM35775
UniProt: B9JT62
Position
1:918129..919829
Genome map
AA seq 566 aa AA seqDB search
MTLDAADKVTSSYAQGLFQHALDEFAALLPPARQDPRMIIMAAQCHYRLGHFETAADHYT
LAADLVATDGIRLNKVAFELYKKAGHTEKAFASAERILQVEPRDHAAAIFRRHHLFDFLR
LDELKAANDAALPAIQAGDEFAMSCELPFNILHWCSDESIQARILGEGRPDISPQIRAMR
RQKPHVFGDKIRIGYLSNDFFSSHATMILLQGVLERHDRSRFEIILYCYSNKALVESDNG
SRARMGMIKQIGDLSDAAASTMIQNDDLDILVDLKGHTKDARIGLVNSGLAPIQVAWLGF
PGSGIGIDCDYIIGDPIVTPQSSKPFYQEKFCRLPETYQPNDNINRPLPPAVPRAALGLP
QDRFVLASFNSIKKLSPQTVEAWLKIMADLPDSILWILCRSDIAKDNLRTLFARHGLSAE
RLIFTPPLAYPYHLARLSAADLVLDSFPYCGHTTTSDCLWAGVPVLALKGQNFASRVSES
LLTALGVPELVAATVDDYIAQAQDLAHNRNRLQELRDRIAANRHTTPLFDTDRFTRHLED
AYWMMVERAKAGLEPDHMDVPARPFP
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaccttggatgctgccgataaagtcacttcatcctatgcccagggtctgtttcaacat
gccctcgatgaatttgccgcactcttgccgcctgccaggcaagatccgcgaatgatcatc
atggctgcccaatgccattatcggcttgggcatttcgagacggcggcggatcattatact
cttgcagcggacctcgttgccactgatggcataaggctgaacaaagttgcattcgaactc
tataaaaaggccgggcatactgaaaaagcctttgcctcagccgaacgcatattgcaggtt
gagccgagagaccatgctgccgctatttttcgccggcatcatttgttcgatttcctaagg
ttggatgagctgaaagctgccaatgatgcggcattaccggcaatacaggcgggtgatgaa
tttgccatgtcctgcgaactgccgttcaacattctccactggtgcagcgatgagagcatt
caagcccgtatcctgggcgagggccggccagatatatcgccgcagatccgcgcaatgcgc
cggcaaaaaccacatgtctttggtgacaagatcaggattggctatctttccaacgatttt
ttcagttctcatgcgacgatgatcctgttgcagggcgtgcttgagcgccatgacagaagc
cgtttcgagattatcctctattgctattcaaacaaggcattggtcgaaagcgacaacgga
tcgcgcgcccgcatggggatgatcaagcaaatcggcgacctgtctgatgcggcggccagc
acgatgatccagaatgacgacctggacattcttgttgatctgaaaggccataccaaggat
gccagaataggtctggtcaattccggccttgcgccgatacaggtggcctggcttggtttt
ccgggcagcggcatcggcatagactgtgactatatcatcggcgatccgattgtgacgcct
cagtccagcaagccgttttaccaggaaaagttttgccgtttgccggaaacctatcaaccc
aatgacaatatcaaccggcccttgccgccagcagtgccgcgagcagctttgggcttgccg
caggacaggttcgttctggcatccttcaacagcatcaagaaacttagcccgcaaactgtt
gaggcatggctgaagatcatggcggatctgccggacagcatcctgtggatcctgtgcaga
agcgacattgccaaggacaatctccggacactgttcgcgcgtcatggcctgtcagcggaa
cgactgattttcacgccgccacttgcctacccgtatcacctcgccaggctgtccgcagca
gatcttgtcctcgacagttttccctattgtggccatacgaccacatccgattgcctttgg
gccggagtgcccgttctggcgctgaagggccagaatttcgcctcccgcgtttctgaaagc
ctgctgaccgcccttggcgtaccggaactggtggctgcgaccgttgatgattacattgcc
caggcgcaagaccttgcgcacaacagaaaccgtcttcaagaattgcgcgacaggatcgcc
gccaaccggcacaccacgccgctgtttgacaccgaccgctttacccgccatctcgaagac
gcctactggatgatggttgagcgcgccaaggccggattggagcctgatcacatggatgtt
ccggcaaggccgttcccatga

DBGET integrated database retrieval system