KEGG   Agrobacterium vitis: Avi_1162Help
Entry
Avi_1162          CDS       T00851                                 

Definition
(GenBank) conserved hypothetical protein
Organism
avi  Agrobacterium vitis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_41 TPR_16
Motif
Other DBs
NCBI-ProteinID: ACM35828
UniProt: B9JTB5
Position
1:984228..986129
Genome map
AA seq 633 aa AA seqDB search
MDLALNAYRQGAFEKALGHAQAAVKQLARAGKAGQAEMLAANIYLKLGQKIEAAQAFARS
AAALPEKRAEFLKFAAKLYLAERRVDLLEGIAVAAARANADDAGFVGEIANMLLGAGMHP
PLDELVPLLDMTNNWHLQIVINHYQLTRKPDKLKPIIEKRYAESPGDSFVAVNYFMFCRS
SLFFPVARQWLDMMKTPEDPLTAEILYRDQPLSRCYWSDDQAVINGPCGGTDMLQRNVGT
VMPRRAVRPLGEKLKIGYLSSDLTIHATMYLLYDVFLAHDRSRFDVTFFCHTPPGQAAIQ
KTWDPVLQSEIIAVGQMDNDGIAQEISRRGIDILIDLKGHTAGNRLAAVALSDAPVKASW
IGYPGSVRGAGLDYHMTDPIVTPDDAKLWFEEKLCRLPETYQGNCSLTKPRPKPLKRADH
GLPEEVFVFASFNSPAKISPQSITLWASIMNAVPDSLLWILCSGAQLQANFAEEFARLGI
GRDRIVFAQGVDYPDHLSRVGLADLALDTFPYNGHTTTSDLLWGGLPVLTKKGRSFAARV
SESLLTAIGLPELVARDGEEFVERAVEFAAHPEKIVALKQKLEANRLREPLFDTERFTRH
LERAYEMMAARARAGLAPDHIDVPALPIRSMSF
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggatttggcgctcaatgcctaccggcagggcgcgttcgaaaaggctctcggtcatgcg
caggcggcagtcaagcaattggcgcgggccggaaaagccgggcaggccgaaatgctggcc
gccaatatctatctgaagctcggccagaagattgaggccgcgcaagcctttgcccggtcg
gcagcggctttgccggaaaagcgcgccgaattcctgaaattcgccgccaagctttatctg
gccgagcggcgcgtcgatcttctggagggcattgctgttgccgcagcgcgcgccaatgct
gatgatgcgggttttgtcggcgagatcgccaatatgctgctgggggcgggcatgcatccg
ccactggatgaattggtgccgcttctcgatatgaccaataactggcatttgcagatcgtc
atcaaccattaccaattgacacgcaaaccggacaagctgaagccgatcatcgaaaagcgc
tatgcggaaagccccggggacagttttgtcgcggtgaattatttcatgttctgccgctcc
agcctgttctttccggtggcaagacaatggctggacatgatgaaaacgcctgaagatccg
ttgacggcggagatcctttatcgtgaccagcctctatcgcgctgctactggagcgacgat
caggcggtgatcaacggtccttgcggcggcaccgacatgcttcagcgcaatgtgggcact
gtcatgccacggcgcgcggttcgccctttgggcgaaaaactcaagatcggttatctctct
tcggatctgaccatccacgccaccatgtatcttctttacgatgtctttctggcccatgac
cgcagccgtttcgacgttacctttttttgccatacgccgcctggtcaggccgccatacaa
aagacctgggatccggtgctacaatcggaaattatcgctgtcggccagatggataatgac
gggatcgcccaggaaatcagccggcgcggcatcgatattctcatcgatctgaagggacac
acggcgggcaaccggcttgccgctgtcgctctttcggatgcgccggtcaaggccagctgg
atcggttatcccggctcggtgcgtggcgcggggctcgattatcacatgaccgaccccatc
gtcacacccgacgatgccaagctgtggtttgaggaaaagctctgccgcctgccggaaacc
tatcagggcaattgcagcctgaccaagccgcgccccaaaccgttgaagcgggccgatcac
gggctgccggaagaggtctttgtgtttgcctctttcaattctcccgccaagatcagtccg
caaagcatcaccctgtgggcctcgatcatgaacgccgtgccggacagcctattgtggata
ttgtgcagtggtgcgcaattgcaggcgaatttcgctgaggaattcgctcgcctcggcatt
ggccgcgaccgtatcgtctttgcccaaggggtcgattatcctgatcatctcagccgggtg
ggtcttgccgatctggcgctcgacacgttcccctataacggccataccacgacctcggat
ctgctctggggcggcctgccggtcctgacgaaaaagggtcgtagctttgctgcgagggtg
tcagaaagcctgctgacggctatcggcctgcccgaactggtggcgcgggacggtgaagag
tttgtcgaaagggcggtagagttcgccgctcacccggaaaagatcgtcgccctgaaacaa
aagctcgaagccaaccgcctcagggagcctttgttcgacactgagcgcttcacccggcat
ctggaacgcgcctatgagatgatggcggcgcgggccagggcagggcttgcgcccgaccat
atcgacgtgccagccctgccgatccggtcaatgtctttctag

DBGET integrated database retrieval system