KEGG   Agrobacterium vitis: Avi_1388Help
Entry
Avi_1388          CDS       T00851                                 

Definition
(GenBank) AcrB/AcrD/AcrF family protein
  KO
K03296  hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 family
Organism
avi  Agrobacterium vitis
Brite
KEGG Orthology (KO) [BR:avi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Avi_1388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACR_tran MMPL SecD_SecF
Motif
Other DBs
NCBI-ProteinID: ACM35989
UniProt: B9JU61
Position
1:complement(1164420..1167551)
Genome map
AA seq 1043 aa AA seqDB search
MIPAFCINRPVATILLAIGLVLAGLAGYRLLPVAALPKVDFPTINVTATLSGASPETMAT
SVSTPLIKQFETIPGISEISATNSLGNSSVVLQFDLNRDIDAAAADVQAAISRASRQLPS
NMTSDPSYRKTNPADSPVLLLAINSDEMPRSQVDSIAENIISPLLSTLNGVAQVSIYGSQ
TYAVRIGVDPAKLQARGLGVDTLTSAIADANSQVPIGTLQMANQSLTINANTQRTNAEEF
KSLVISTSNGAPIHLSDVANVRDSVDNLDAGSWFDGKQAIILAIQRQPDANTVEVVDEIM
AKLPALQKQLPPSLKINVMNDSSNSIREAIHDVQFTLFLTIALVILVIYLFTGHLTATLI
PGLAVPLSLIATFGGMYVLGYSIDNISLLGLTLAVGLVVDDAIVMLENILRHVEEGMPPL
QAALKGAGEVSYTIISMSISLVAVFIPILLMGGVVGRLFNEFGMVVTMAILSSALVSLTV
TPMLAARISSHSSRPPLIVRWFDAGFAKTQSGYDKSVRWCLNHRFVVMMVFVASIAGSGW
LFHTLPSSFFPQEDIGRLTVSTQAREDISYAAMRDLQQKVADELKTNPAVDHVTSIVGGS
SRSPLNNGTIFVQLKPKDDRPPLAQTLNEMRQKLSKIAGIRSYITPQQNLRFGGRSTASQ
YQLVVQALSTTATDEWSSKIQAAMRQDPLFTDVTSDAQNNAIAADINIDNGKAAAFGITN
DQLRKTLEMAFSGYNAAQIQSTGDSYDVIVEFDRNKPWDDEFLRDILVRSSSTGTLVPLS
NFATVKRHNAPVTVNQTGQLVSTTVSFNLPDGISLSDATARIDQIKTEIGVPNDVFTSYG
GTAAIFQQSQSNTGLLILAAVLTIYVVLGVLYESFIHPLTILSGLPAAAFGALLALKLLN
FDMSVIALIGLLMLIGIVKKNAIMMIDVAVELIREHGETPAKAIHEACVRRFRPIMMTTF
CALLGALPIALGHGASSELRQPLGIAVVGGLIVSQLLTLFITPVIFVEMDRFGKFLTRLV
RRDKGHHAANSEDGPSKPAMAAE
NT seq 3132 nt NT seq  +upstreamnt  +downstreamnt
atgatccctgctttttgcatcaatcggcctgttgccaccattctgcttgccatcggcctg
gtcctggctggattggccggttatcggcttttgccggtggccgctctgcccaaggtggac
tttcccaccatcaacgtgacggcgaccctgtcaggcgcctcgccggaaaccatggcgacg
tcggtttccaccccgctgatcaagcagttcgagaccatccctgggatcagcgaaatcagc
gcgaccaactcgctgggcaattcctccgtcgttctccagttcgacctgaaccgtgatatc
gatgccgccgccgctgacgttcaggcggcaatttcccgcgccagccgtcagttgcccagc
aacatgacgtcggatccgagctatcgcaagaccaatccagccgactcgccggtgctgctc
ctggccatcaacagcgatgagatgccgcgcagtcaggtggattcgattgcggaaaatatc
atttccccgctgctgtcgacactgaacggcgtggcgcaggtcagtatctatggttcgcag
acctacgcggtgcggatcggtgtcgatcccgccaagctgcaagcgcgcgggcttggcgtc
gacacgctgacctcggcgattgccgatgccaatagccaggtgccaatcggcaccttgcag
atggcaaatcagtcgctgaccatcaatgccaatactcagcgcaccaatgccgaggaattc
aagtcactggtgatctccaccagcaatggcgccccaatccacctttccgatgtcgccaat
gtgcgcgacagtgtcgacaatctcgacgcgggcagttggttcgatggcaaacaggcgatc
atcctcgccattcagcgacagccggacgccaataccgtcgaagtggtcgacgagatcatg
gcaaagctgcctgccctgcaaaagcagctgccgccttcgttgaagatcaatgtgatgaac
gattcgtcaaactcgatccgcgaggcgatccatgacgttcagttcacgttgttcctcacc
atcgcccttgtcatcctggtcatctatctgttcaccggccatctgaccgcgacccttatt
cccggtcttgccgtgccgctttcgctgattgcaacctttggcggcatgtacgtgcttggc
tacagtattgacaatatctcactgctcggcctgacgctggcggtgggtctggtggtggat
gacgccatcgtcatgctggaaaatatcctgcgccatgtcgaagaaggcatgccgccgctt
caggccgcccttaaaggcgccggcgaggtcagctacacgattatttccatgtcgatctca
ctggtggcggtattcattcctatcctgttgatgggtggtgttgtcggacgcttgttcaat
gagttcggcatggtcgtcaccatggccattctgtcttccgccctggtgtccctgacggtc
acgccaatgctggcagcccgcatttcctcccacagcagccgcccaccgctgatcgtgcgc
tggttcgacgccggttttgccaagacgcagagcggctatgacaagtctgtccgctggtgt
ctcaaccaccgttttgtggtgatgatggtctttgtggcctccatcgcaggctccggctgg
ctgttccacacgctgccatccagcttcttcccacaggaagatattggccggctgacggtc
agcacccaggcccgtgaggatatttcctatgcggccatgcgcgatcttcagcaaaaggtc
gccgacgaattaaagaccaatccggctgtcgatcatgtcacctccatcgtcggtggctca
agccgcagcccgctcaacaacggtacgatcttcgtccagctgaaaccgaaggacgaccgt
ccgcctctcgctcaaaccctcaacgagatgcgacagaagctgtccaagatcgccggtatc
cgtagctatatcacaccacagcagaatctgcgtttcggtggccgcagcaccgccagccag
tatcagctcgtcgtccaggcactgagcacgacagcaaccgatgaatggtcatcgaagatc
caggccgctatgcgccaggatccgttgtttaccgatgtgaccagcgatgcgcagaacaat
gccattgctgccgatatcaacatcgacaatggcaaggccgctgctttcggcattaccaac
gaccagcttcgcaagaccctggaaatggcgttcagcggttataatgctgcccagattcag
tcgaccggcgacagctacgatgtcatcgtcgagttcgacaggaacaagccatgggacgac
gagttcctgcgcgatatcctggtgcggtcttcttccacgggaacgctggtgccgctgtca
aacttcgccaccgtcaagcgtcataacgcgcctgtcactgtcaaccagaccggccagctg
gtctcgaccacagtgtcgtttaacctgcccgacggcatatcgctgagcgacgctaccgcc
cggatcgatcagatcaagaccgagattggcgtgcccaatgacgtcttcacctcctatggc
ggtacggcggcgattttccagcagtcgcaaagcaataccggcctgctgatcctggctgcc
gtgctgacgatctatgtggtgctgggcgtgttgtatgagagcttcatccatccgctcacc
attctctccggcctgccagcggcggctttcggggcgcttctggccttgaaactgctgaat
ttcgacatgtcggtcatcgcactgatcggcctgctgatgctgatcggcatcgtcaagaaa
aatgcgatcatgatgatcgacgtggcggtggaattgatccgcgagcatggcgagacaccg
gcaaaggccattcacgaggcctgtgtgcggcgtttccggccgatcatgatgaccaccttc
tgcgcgcttctcggagcactgcccattgcgcttggccatggcgccagttccgaactccgc
cagccgctcgggatcgccgttgtcggcggcctgatcgtctcacaattgctcacactgttc
atcacacctgtcatcttcgtggaaatggaccggttcggcaaattcctgacccggctcgtt
cgccgcgacaagggtcaccacgcggcaaacagcgaagatgggccatccaaaccagccatg
gcggctgaatag

DBGET integrated database retrieval system