KEGG   Agrobacterium vitis: Avi_1843Help
Entry
Avi_1843          CDS       T00851                                 

Gene name
rplB
Definition
(GenBank) 50S ribosomal protein L2
  KO
K02886  large subunit ribosomal protein L2
Organism
avi  Agrobacterium vitis
Pathway
avi03010  Ribosome
Brite
KEGG Orthology (KO) [BR:avi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Avi_1843 (rplB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:avi03011]
    Avi_1843 (rplB)
Ribosome [BR:avi03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Avi_1843 (rplB)
  Bacteria
    Avi_1843 (rplB)
  Archaea
    Avi_1843 (rplB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L2_C Ribosomal_L2
Motif
Other DBs
NCBI-ProteinID: ACM36320
UniProt: B9JVP0
Position
1:1534427..1535263
Genome map
AA seq 278 aa AA seqDB search
MALKNFNPTTPSQRQLVIVDRSGLYKGKPVKSLTEGLSSKGGRNNLGRITVRFQGGGHKR
TYRLVDFKRRKFDVEGTVERLEYDPNRTAFIALITYADGEQAYILAPQRLAAGDKVIASD
KAVDVKPGNAMPLQYVPVGSIVHNVELKPGKGGQVARSAGAYVQLVGRDAGMAILRLSSG
EQRLVHGTCLATVGAVSNSDHGNINDGKAGRSRWRGKRPHVRGVVMNPVDHPHGGGEGRT
SGGRHPVSPWGKPTKGKRTRSNKSTDKFIMRSRHQKKK
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggcattgaaaaatttcaatccgacaaccccgagccagcgtcagctggtcatcgttgac
cggtcgggcctttacaagggcaagcctgtcaagtcgctgaccgagggtctgtcttcgaag
ggcggtcgcaacaatctcggtcgcatcaccgttcgctttcagggcggtggtcacaagcgc
acctatcgtctggtggacttcaagcgtcgtaagttcgacgtagagggcactgtcgagcgt
ctggaatacgaccccaaccgtacggcgtttattgcgctgatcacctatgccgatggcgag
caggcctatatcctggctccgcagcgtttggcagccggtgacaaggttatcgcatcggac
aaggctgtcgacgtcaagcccggcaacgctatgccgctgcaatacgtcccggtcggctcc
atcgttcacaatgtcgagctgaagcccggcaagggcggtcaggttgcccgttccgctggt
gcctacgttcagctggtcggtcgcgatgccggcatggctatcctgcgccttagctcgggt
gaacagcgcttggtgcacggcacttgccttgcaacggtcggcgccgtgtcgaactccgat
cacggcaacatcaatgacggcaaggctggtcgttcgcgttggcgcggtaagcgcccgcac
gttcgcggtgtcgtcatgaacccagtcgaccacccgcacggcggtggtgaaggccgcacc
tccggtggccgtcatccggtttccccttggggtaagccgaccaagggcaagcgtacgcgg
tcgaacaagtccacggacaagttcatcatgcgttcccgccaccagaagaagaagtaa

DBGET integrated database retrieval system