KEGG   Agrobacterium vitis: Avi_2131Help
Entry
Avi_2131          CDS       T00851                                 

Gene name
ispD
Definition
(GenBank) 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
  KO
K12506  2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase / 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [EC:2.7.7.60 4.6.1.12]
Organism
avi  Agrobacterium vitis
Pathway
avi00900  Terpenoid backbone biosynthesis
avi01100  Metabolic pathways
avi01110  Biosynthesis of secondary metabolites
avi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:avi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Avi_2131 (ispD)
Enzymes [BR:avi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.60  2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
     Avi_2131 (ispD)
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.12  2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
     Avi_2131 (ispD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IspD YgbB NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACM36519
UniProt: B9JW91
Position
1:complement(1745651..1746874)
Genome map
AA seq 407 aa AA seqDB search
MVHIQADGARSTAVILVAAGRGERAGASSEGPKQYRRIGGKPVIVHSLLGFADLLPQATL
IVVIHPDDGALLANALAPYPQLAASLTITHGGKTRQQSVLAGLRALRNQKPDYVLIHDAV
RPFFDQLMLQRIIARLDDGADAVLPAIPVTDTLKRGDEGARVVDTVARSGLFAAQTPQSF
HFAKILAAHEDAASAGREDFTDDAAIAEWAGLTVHLVEGSPDNVKLTVKRDLEMADARLS
HNALPDVRTGNGYDVHQLVPGDGVTLCGIFIAHDQALSGHSDADVALHALTDALLATCGA
GDIGDHFPPSDPQWRGAASRIFLEHAANIVRDAGGTIMNADISLIAEAPKIGPHRQIMRE
KLSEILGIALERCSVKATTNEKIGFVGRGEGIAAIATATVVFQGKPQ
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggtgcatattcaagcggacggggcaaggtcaacagcggtgatattggtcgcggcaggc
cggggagagcgcgctggcgcctccagcgagggaccgaagcaatatcggcggatcggcgga
aagcctgttattgtccatagcctgctaggcttcgcagatcttctcccgcaggcgaccctg
atcgtcgtcattcatcccgatgacggggccttgctggccaatgctctagccccctatccc
cagctcgctgcctctctgaccatcacccacggcggcaaaacccggcagcaatcggttctg
gctggcttgagagccttgcggaatcaaaagccggattatgtgctgatccatgacgcggtg
cgaccgtttttcgatcagctgatgctgcaacgaattatcgcccggcttgacgacggtgcc
gatgccgtcttgcccgccatcccggtgaccgatacgcttaaacgtggcgatgagggtgcg
cgagtcgtcgatactgtggcgcgcagcggactttttgcagcacaaacaccgcagagcttc
cactttgccaaaatactggctgctcacgaagacgccgcaagcgctggacgagaggatttc
accgatgacgccgccatcgccgaatgggcgggactaactgtccatctggtggaaggctcg
cctgacaatgtaaaactgaccgtgaaacgggatcttgaaatggccgatgcccgcctctct
cataacgctttgcctgatgtgcgcaccggcaatggctatgatgtccaccaactggtgccg
ggcgatggcgtaacgctttgcggcattttcattgcccatgaccaggccttgagcggacat
tccgatgccgatgtcgccttgcacgccctgaccgatgcgctactggccacctgcggggct
ggcgatatcggcgaccatttcccgccatcagacccgcaatggcgcggtgccgcgtcgcgg
atcttcctggagcatgcagcaaacatcgtgcgcgatgcgggcggtacaatcatgaatgct
gacatctcgctgattgcagaagcaccaaaaatcggcccgcatcgccagatcatgcgcgaa
aagctttccgagattctcggcattgcgctggagcgctgctctgtcaaagcgacgaccaac
gagaaaatcggctttgtcggccggggcgaaggtattgcagccattgccactgccacggtg
gttttccagggaaagccacaatga

DBGET integrated database retrieval system