KEGG   Agrobacterium vitis: Avi_2567Help
Entry
Avi_2567          CDS       T00851                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
avi  Agrobacterium vitis
Pathway
avi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
avi01100  Metabolic pathways
avi01110  Biosynthesis of secondary metabolites
avi01130  Biosynthesis of antibiotics
avi01230  Biosynthesis of amino acids
Module
avi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Avi_2567 (trpC)
Enzymes [BR:avi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Avi_2567 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ACM36842
UniProt: B9JX64
Position
1:2122036..2122851
Genome map
AA seq 271 aa AA seqDB search
MSDILKKIEAYKREEIAAAKNAVPLDEIKARAADQPPARGFYKALRAKQAAGNFGLIAEI
KKASPSKGLIRPDFDPPALASAYEAGGAACLSVLTDAPSFQGAPDFLVAARAACTLPALR
KDFMFEAYQVHEARAWGADCILLIMASLSDSEATDLEGEALALGMDVLIEVHDEEEMLRA
LKLASPLVGINNRNLRTFEVDLAVSERLAAMVPADRLLVGESGIFTHEDCLRLQKSGIET
FLVGESLMRKDDVTGATKALLTGASDRIAAE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacatcctgaagaaaatcgaagcctataagcgcgaggaaatcgcggcagccaag
aatgccgtaccgctggacgagatcaaggcccgcgccgccgaccagccaccggcacgtggc
ttctacaaggcattgcgggcaaagcaggcagctggcaatttcggactgattgccgaaatc
aagaaagccagcccgtccaaaggtctgatccgtcccgattttgacccaccggcgctggct
agcgcctatgaagcgggcggggctgcctgtctgtccgtgctgaccgacgctccaagcttt
caaggtgcaccggattttctggtcgcagcccgcgcggcctgcacacttccagcgctgcgc
aaggatttcatgttcgaggcctatcaggtgcatgaagcgcgtgcctggggcgcagattgc
atcctgctgatcatggcgtccctgtcagattctgaggccaccgatctggaaggggaagcc
ctggcgcttggcatggacgtgctgattgaggtgcatgatgaagaggaaatgctgcgggcg
ctgaaactcgcctcaccgctcgtcggcatcaacaatcgcaatctgcggacgttcgaggtc
gatcttgccgtcagcgaacggctggccgccatggttcctgcagatcggttgctggttggt
gaaagcggaattttcacccacgaagactgccttcgcctgcaaaaatccggcatcgaaact
ttcctggtcggagaaagcctgatgcgcaaagacgatgtgactggtgccaccaaggcgctc
ttgactggtgcatccgaccgcatagccgccgaatga

DBGET integrated database retrieval system