KEGG   Agrobacterium vitis: Avi_3724Help
Entry
Avi_3724          CDS       T00851                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
avi  Agrobacterium vitis
Pathway
avi00040  Pentose and glucuronate interconversions
avi00052  Galactose metabolism
avi00500  Starch and sucrose metabolism
avi00520  Amino sugar and nucleotide sugar metabolism
avi01100  Metabolic pathways
avi01130  Biosynthesis of antibiotics
Module
avi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Avi_3724 (galU)
   00052 Galactose metabolism
    Avi_3724 (galU)
   00500 Starch and sucrose metabolism
    Avi_3724 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Avi_3724 (galU)
Enzymes [BR:avi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Avi_3724 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACM37679
UniProt: B9JS51
Position
1:complement(3088616..3089503)
Genome map
AA seq 295 aa AA seqDB search
MGQLKKIRKAVFPVAGLGTRFLPATKAVPKEMLTVVDKPVIQYVVDEAVEAGIEHFVFVT
GRGKGVIEDYFDIQYELEQTLKSRNKNAELTLLSEILPKAGATSFTRQQEPLGLGHAVWS
AREIVGDEPFAVLLPDMIMRGETACMKGMVDLYNKAGGNILAVEECAPDQAHKYGIVGVG
ETLDGGFKITEMVEKPAKGTAPSNFFINGRYILQPEIFSILETQERGAGNEIQLTDGMLK
LAKIQQFAGYHFKGETFDTGAKDGFILANVAFALSRPDLRGLVEEPMKALLAALK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtgggacaactgaaaaaaattcgtaaagccgtgtttccggttgccggtcttggaactcgt
ttcctgcccgccaccaaggccgtgccgaaggaaatgctgactgttgtcgataagccagtc
atccaatatgtggtggatgaggccgtggaagccgggatcgaacatttcgtgtttgtcacc
ggacgcggcaagggcgtgattgaagactatttcgatattcagtacgagcttgagcagacc
ctgaagtcgcgcaacaaaaatgcagaattgacactgctgtccgaaatcctgcccaaggca
ggcgccaccagcttcacccgccagcaggagccgctgggccttggccatgcggtgtggagc
gcccgcgaaatcgttggcgacgagcctttcgctgtcctgctgcccgatatgatcatgcgt
ggcgagacggcctgcatgaagggcatggtcgatctctacaacaaggctggcggcaatatc
ctcgccgtcgaggaatgtgcgcccgatcaggcgcataaatacggcatcgtcggtgtcggt
gagacgctggatggcggcttcaaaatcactgaaatggtggaaaagccagccaagggcacg
gcgccctcgaacttcttcatcaatggccgctatatcctccagccggaaatcttctcgatt
ctggaaactcaggaacgcggcgcgggcaacgagatccagttgaccgatggcatgttgaaa
ctggccaagatccagcaatttgccggctatcacttcaagggtgaaaccttcgatacgggt
gccaaggacgggttcattctcgccaatgtcgctttcgccctgtcgcgtcccgaccttcgc
ggtctggtggaagagccgatgaaggcgttgctggccgctttgaagtaa

DBGET integrated database retrieval system