KEGG   Agrobacterium vitis: Avi_3736Help
Entry
Avi_3736          CDS       T00851                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
avi  Agrobacterium vitis
Pathway
avi00260  Glycine, serine and threonine metabolism
avi01100  Metabolic pathways
avi01110  Biosynthesis of secondary metabolites
avi01120  Microbial metabolism in diverse environments
avi01130  Biosynthesis of antibiotics
avi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:avi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Avi_3736
Enzymes [BR:avi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Avi_3736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase FliC_SP
Motif
Other DBs
NCBI-ProteinID: ACM37687
UniProt: B9JS59
Position
1:3102724..3103770
Genome map
AA seq 348 aa AA seqDB search
MFFASDNWAGAHPAIAESLMKEAAGYASAYGTSDLDRRVEAHFNEIFEREVSVFFVGTGT
AANSLALASVARAGGVTFCHFDAHVNADEGGAPEYLANASRLYPVEGRDGKMSAAALHTA
VSRFDTPSVHQGRPMAVTITQATEAGTIYTLDEIAAISAIARAKSLPLHMDGARFANALV
ALDATPAEMTWKRGVDILSFGGTKNGCWCVEAIVFFNPDMAEEMPYIRKRSAQLFSKTRF
VSAQLEAYFKDDLWLDLARHANAMAERMRAGLSKNNKARLAWQTESNEVFAVIGKDAARQ
AEARGAKFYEWLAPRDEPGLVGQDNVLIRLVTSFATTEQDVDQFLDIL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgttctttgcatccgataattgggccggagcccatcccgccattgctgaaagcctgatg
aaggaagcggcgggctatgccagcgcctatggcaccagcgatctcgaccggcgcgtcgaa
gcgcatttcaatgagattttcgagcgtgaggtctcggtgttcttcgttggcaccggcacg
gcggccaattcgctggcgctggccagtgtggcgcgggccggtggcgtcaccttctgccat
ttcgacgcacatgtgaatgccgacgaaggtggcgcgccggaatatctggcaaatgccagc
cggctctatccggtcgaaggccgcgacggcaagatgagcgcggcagccctgcacaccgcc
gtttcgcgctttgacacgccttccgtccatcagggccggcccatggcggtgacgattacc
caggcgaccgaagctggcaccatttatacactggacgaaatcgccgcaatcagcgccatt
gcccgcgccaaatccctgcctctgcacatggacggcgcccgttttgccaatgcgctggta
gcgctcgatgccacgcccgccgaaatgacctggaagcgcggtgtcgatattctctccttc
ggcggaaccaagaatggctgctggtgcgtggaagccatcgtgttcttcaaccccgacatg
gccgaggaaatgccctatatccgcaagcggtctgcgcagctgttttccaagacccgcttc
gtttccgcccagctggaagcctatttcaaggacgatctgtggctggatctggcccgccac
gccaatgccatggctgagcgaatgcgcgccggtctcagcaaaaacaacaaggcccgtctg
gcctggcaaaccgagagcaatgaagtctttgcggtgatcggcaaggatgccgccaggcag
gccgaggcccgcggcgcgaaattctacgaatggctggcaccccgcgatgagcccggattg
gtcggtcaggacaatgtgttgatccggctggtaacaagctttgccacgacagagcaggat
gtcgatcagtttctcgacattctctaa

DBGET integrated database retrieval system