KEGG   Agrobacterium vitis: Avi_4377Help
Entry
Avi_4377          CDS       T00851                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
avi  Agrobacterium vitis
Pathway
avi00010  Glycolysis / Gluconeogenesis
avi00620  Pyruvate metabolism
avi00640  Propanoate metabolism
avi00680  Methane metabolism
avi01100  Metabolic pathways
avi01110  Biosynthesis of secondary metabolites
avi01120  Microbial metabolism in diverse environments
avi01130  Biosynthesis of antibiotics
avi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Avi_4377 (acs)
   00620 Pyruvate metabolism
    Avi_4377 (acs)
   00640 Propanoate metabolism
    Avi_4377 (acs)
  Energy metabolism
   00680 Methane metabolism
    Avi_4377 (acs)
Enzymes [BR:avi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Avi_4377 (acs)
Lipid biosynthesis proteins [BR:avi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Avi_4377 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACM38181
UniProt: B9JV43
Position
1:complement(3708747..3710702)
Genome map
AA seq 651 aa AA seqDB search
MSAKTYPVLKAAKAQALIDNDKYLKWYEESIEEPEKFWSKHGKRIDWFKPYTKAKNTSFK
GKVPIKWFEDGLTNVSYNCIDRHLKTHGERTAIIWEGDNPYIDKRITYNQLYDNVCRLAN
VLKAHGVKKGDRVTIYMPMVPEATYAMLACSRIGAVHSVVFGGFSPEALAGRIVDCESTF
VITCDEGVRGGKPVALKENTDVAIDIAAKQYVIVNKVLVVRRTGGKVGWAPGRDLWYHQE
IAKVKPDCPPVKMKAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAAMTHEYVFDYKDGEI
FWCSADVGWVTGHSYIVYGPLANCATTVMFEGVPNFPDQGRFWEIIDKHKVNIFYTAPTA
IRSLMGAGDDFVKRSSRSSLRLLGSVGEPINPEAWEWYYNVVGDQRCPIVDTWWQTETGG
ILISPLPGATDLKPGSATRPFFGVKPELVDNEGKVLEGAADGNLCLIDSWPGQARTIYGD
HNRFVQTYFSTYKGKYFTGDGCRRDEDGYYWITGRVDDVLNVSGHRLGTAEVESALVSHH
LVSEAAVVGYPHGIKGQGIYCYVTLMAGHEGNEELRQTLIKHVRSEIGPIASPDKVQFAP
GLPKTRSGKIMRRILRKIAEDDFGALGDTSTLADPGVVDDLIANRQNKASA
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgaagacctatcccgttttaaaggccgcgaaggcccaggctttgatcgataac
gacaaatacctgaaatggtacgaggaaagcattgaggagccggagaaattctggtccaag
cacggcaagcggatcgattggttcaagccctataccaaggccaagaataccagtttcaag
ggcaaggtgccgatcaaatggttcgaggacgggctgaccaatgtctcctacaattgcatc
gaccgccatctgaaaacccatggtgagcgcaccgcgatcatctgggaaggggacaatccc
tatatcgacaagcggattacctacaaccagctttatgacaatgtctgccggcttgccaat
gtgctgaaagcgcatggcgtcaagaaaggcgaccgcgtcaccatctatatgcccatggtg
ccggaagcgacctacgccatgctggcgtgttcgcgtattggtgctgtgcattcggtggtg
tttggcggtttttcgcctgaagccctggctggccggatcgtcgattgcgaatcgaccttc
gtgatcacctgtgatgaaggggtgcgcggcggcaagccggtggcgctcaaggaaaacacc
gatgtcgccatcgacattgcggcgaaacaatatgtcatcgtcaacaaggtgttggtggtg
cgccgtacgggcggcaaggtcggctgggctccggggcgcgatctctggtaccatcaggaa
atcgccaaggtgaagccggattgcccgccggtgaagatgaaggcggaagatccgctgttc
attctctacacctccggctccaccggcaagccaaagggcgtgctgcacacgaccggtggc
tatctcgtctatgcggcgatgacccacgaatatgtgttcgactacaaggacggcgagata
ttctggtgctcggcagacgtgggttgggtgaccggccattcctatatcgtctacgggccg
ctggccaattgcgcgacgacggtgatgttcgaaggcgtgcccaatttccccgaccaggga
cggttctgggaaatcatcgacaagcacaaggtcaatattttctataccgcgcccaccgcc
atccggtcgctgatgggggccggagacgatttcgtcaagcgttcctcgcgctcaagcctg
cgattgctgggctcggtcggtgagccgatcaatccggaagcctgggagtggtattataac
gtggtcggtgatcagcgctgccccattgtcgatacctggtggcagaccgagacgggcggt
attctgatcagccccctgcccggcgccacggatctcaagcccggttccgcgacccggccg
ttctttggcgtcaagccggaactggtggacaatgaaggcaaggtgctggaaggcgctgcc
gatggcaatctctgcctgatcgacagctggccgggccaggcccggacgatttacggcgac
cacaatcgcttcgtccagacctatttctccacctataagggtaagtatttcactggagat
ggctgccgacgcgacgaggacggttattactggatcaccggtcgtgtcgatgacgtgctg
aatgtgtccggccaccgtctgggaactgccgaagtggaatcggcgctggtctcgcatcat
ctggtctcggaagccgccgtggtcggttatccgcacggcatcaagggtcagggtatttat
tgctatgtgacgctgatggcgggccatgagggcaatgaggaactacgtcagacgctgatc
aagcatgtccgttccgaaatcggcccgattgcctctcccgacaaggttcagttcgctccc
ggcctgccgaaaacccgctccggcaagatcatgcgccgcatcctgcgcaagatcgccgag
gacgattttggcgcgctgggcgatacatcgacgctcgccgatcctggcgttgtcgacgac
ctgattgccaaccggcagaacaaagcatccgcctga

DBGET integrated database retrieval system