KEGG   Agrobacterium vitis: Avi_5694Help
Entry
Avi_5694          CDS       T00851                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
avi  Agrobacterium vitis
Pathway
avi00053  Ascorbate and aldarate metabolism
avi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    Avi_5694
Enzymes [BR:avi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     Avi_5694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 NAD_binding_10 Polysacc_synt_2 adh_short Ldh_1_N NmrA Metallophos_2
Motif
Other DBs
NCBI-ProteinID: ACM38776
UniProt: B9K1M8
Position
2:complement(718853..719620)
Genome map
AA seq 255 aa AA seqDB search
MMTRLLITGAAGNIGTTLAPRLSALGYDLVLSDLHDNAARGIKGADLGDFDAICAVMQGV
DGVIHLGGMANEASFETVLNANIRGTYHIFEAARRLGVPRIVLASSYHVVGLHPFGAPID
ETAPMLPDSFYGLSKAYGELLARTYHDKCGIQSVSVRIGSCFDTVRSPRMLTTWISADDL
TRLVDRAFNVETLGCLMVYGVSDNDRGCMVSSDADKLGWKAQDRSQDAPMDQGRESEIIG
PLLGGPFAEAPLPQN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
ttgatgacccgtctcctgatcaccggtgccgccggcaatatcggcaccacgcttgcaccg
cgcctatccgcgcttggctatgacctggtgttgagcgacctgcatgacaatgcggcccgg
ggcatcaaaggtgccgatctcggcgatttcgatgcgatatgcgccgtcatgcaaggtgtg
gacggcgtcatccatctcggcggcatggccaatgaggcatcgttcgaaaccgtgctgaat
gccaatattcgcggcacctatcacatattcgaagccgcccgacgccttggcgtcccgcgt
atcgtgctggccagttcctaccatgtcgtcggcttacacccgttcggggcgccaatcgat
gagaccgcgccaatgctgcccgacagtttctacggcctgtccaaggcctatggtgagttg
ctggcccgcacctatcacgacaaatgcggcattcaatcggtatccgtgcgcatcggctcc
tgcttcgatacggtgcgcagcccccgtatgcttaccacatggatcagtgccgatgacctg
acccgtctcgtcgaccgcgccttcaatgtcgagacgctcggctgcctgatggtttacggc
gtctccgacaatgatcgcggctgcatggtgagtagcgacgccgataagctcggctggaaa
gcgcaggaccggtcacaggacgcgccgatggaccagggccgcgaaagcgagatcatcggt
cccctgctgggcggaccatttgccgaagcccccctgccacaaaactaa

DBGET integrated database retrieval system