KEGG   Agrobacterium vitis: Avi_5977Help
Entry
Avi_5977          CDS       T00851                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
avi  Agrobacterium vitis
Pathway
avi00220  Arginine biosynthesis
avi00330  Arginine and proline metabolism
avi01100  Metabolic pathways
avi01110  Biosynthesis of secondary metabolites
avi01130  Biosynthesis of antibiotics
avi01230  Biosynthesis of amino acids
Module
avi_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:avi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Avi_5977 (rocF)
   00330 Arginine and proline metabolism
    Avi_5977 (rocF)
Enzymes [BR:avi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Avi_5977 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase Mif2_N
Motif
Other DBs
NCBI-ProteinID: ACM39003
UniProt: B9K2A5
Position
2:991228..992160
Genome map
AA seq 310 aa AA seqDB search
MECRLIGVPLQIGAGRLGCEMGPSALRIAGLGPMLEELGHRVTDLGNVAPAAFKSLSHPN
PAVHHLPETVAWIETLSEAAYRESADAMPIFLGGDHALSAGTVPGLARRAAEQGRPLFVL
WLDAHTDFHTLETTESGNLHGTPVAYFTGQPGFTGYFPDLVEAVDPAHVAMIGIRSVDPA
ERAALRRTGITVHDMRMIDEHGVAVLLRAFLDKVRAANGLLHISFDVDFLDPMIAPAVGT
TVPGGATFREAHLVMEMLHDSGLVSSLDLVELNPFLDERGRTAILMADLTASLMGRQVMD
RPTRDYAGSV
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggagtgcagattgatcggagttcccttgcagatcggggcgggccgtctgggctgtgaa
atgggaccgagcgcgctgcgtattgccgggctcggcccgatgctggaagagctcggccat
cgcgtcaccgatctcggcaatgtcgcgcctgccgccttcaagtcccttagtcatcccaat
ccggctgtgcatcacctgccggaaaccgttgcctggatcgagaccttgtccgaggccgct
taccgcgaaagtgcggatgccatgccgatttttctgggtggtgaccacgcgctttcggct
ggcacggtaccggggctggcgcgccgggcggcggaacaaggccgaccgctttttgtgctc
tggctggatgcccataccgatttccatacgctggaaaccacggaaagcggcaatctgcat
ggtacgccggtggcttatttcaccggtcaaccgggttttaccggctattttccggatctg
gtggaagcggtcgatccggctcatgtggcaatgatcggcattcgcagtgtcgatccggcg
gaacgcgccgctttgcgccggaccggcatcaccgtgcatgacatgcggatgatcgatgag
catggcgttgccgtgctgctgcgggcttttctggataaggttcgggccgcgaatggcttg
ctgcatatcagtttcgatgtggattttctcgatccgatgattgcgcccgccgttggcacc
acagtgccgggtggtgcgaccttccgcgaggcgcatctggtgatggaaatgctgcatgac
agcggcctggtctccagccttgatctggtcgaactcaaccctttcctggacgagcggggc
cgcaccgcaatcctgatggcggatctgaccgccagcctgatgggacggcaggtcatggac
cgtccgacacgcgattatgccgggagcgtttga

DBGET integrated database retrieval system