KEGG   Agrobacterium vitis: Avi_7649Help
Entry
Avi_7649          CDS       T00851                                 

Definition
(GenBank) zinc-binding dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
avi  Agrobacterium vitis
Pathway
avi00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:avi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Avi_7649
Enzymes [BR:avi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Avi_7649
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Avi_7649
    1.1.1.-  
     Avi_7649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ACM40234
UniProt: B9K5T6
Position
pAtS4e:584910..585983
Genome map
AA seq 357 aa AA seqDB search
MRALRFHAAKDLRLDDIAEPKRPGPGQVLVRNRFVGICGTDLHEYSYGPIFIPTEPHPFT
GAHGPQVLGHEFGGFVEAIGEGVTSVVVGDRVSIQPLVMPRSGDYFADRGLFHLSTQLAL
VGLSWDGGGMADAALVNDYNVQKIPEEMSDEEAALVEPTAVAVYACDRGGVTAGTSVLVT
GAGPIGMLTLLAARAAGATQLFVSDLNDSRLALAKGVLPDVITINPQRDNVGDVVRLQTE
GNVGCDVAIECVGNEHALKACVDAVRKQGVVVQTGLHPHENPIDWFQVTFKDLEIKGSWA
YPTHYWPRVIRLIASGQLPAMKIVTKRVTLDTAVKEGFDVLLDPAGAQLKILIDLSK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgcttagatttcatgcagccaaggatttgcgactggacgacattgccgagccg
aagcgaccgggaccaggtcaggttctggtccgtaatcgcttcgtcgggatttgcggcacg
gatcttcatgaatacagctacggcccgatcttcatcccgaccgagccacaccccttcacc
ggcgcccatggcccgcaagtgctcggccatgaattcggcggcttcgtcgaggcgattggc
gagggcgttacgtccgttgttgttggcgaccgcgtatccatccagcccctcgtcatgcca
aggtccggcgactatttcgccgatcgcggccttttccacttaagcacgcagttagcgctg
gtgggcttgagctgggatggcggcggcatggccgacgcagcgctcgtcaatgactacaat
gtccagaaaatcccggaggagatgagcgatgaagaggcagccctggtcgagccaacggcg
gttgctgtctatgcctgcgatcgcggcggcgtaacggctggcacaagcgtcctcgtgacg
ggcgctggtcccatcggcatgctgacgttgcttgccgcgcgcgcggcgggcgccacccag
ctttttgtgtccgacctcaatgactccaggctcgcgcttgcgaaaggggtgttgcccgat
gtcatcacgatcaacccgcagcgcgacaatgtcggtgatgtcgttcgcttgcaaacggaa
ggcaacgtcggctgcgatgtcgccatcgaatgcgtaggcaacgaacatgcgctgaaggcc
tgcgtcgacgccgtgcgcaagcagggcgtcgtggtccagaccgggttgcatccgcatgaa
aatccgatcgactggttccaggtgacattcaaagatctcgaaatcaaagggtcctgggcc
tacccgacacattattggccacgggtcatcaggctgattgcttccggccagctgccggca
atgaagatcgtcaccaagcgcgtcaccctcgacacagctgtcaaagaaggcttcgacgtc
ctgctcgacccggcgggagcccaactcaagatcctgatcgatctttcgaaatag

DBGET integrated database retrieval system