KEGG   Agrobacterium vitis: Avi_8187Help
Entry
Avi_8187          CDS       T00851                                 

Gene name
adhP
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
avi  Agrobacterium vitis
Pathway
avi00010  Glycolysis / Gluconeogenesis
avi00071  Fatty acid degradation
avi00350  Tyrosine metabolism
avi00625  Chloroalkane and chloroalkene degradation
avi00626  Naphthalene degradation
avi01100  Metabolic pathways
avi01110  Biosynthesis of secondary metabolites
avi01120  Microbial metabolism in diverse environments
avi01130  Biosynthesis of antibiotics
avi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Avi_8187 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    Avi_8187 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Avi_8187 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Avi_8187 (adhP)
   00626 Naphthalene degradation
    Avi_8187 (adhP)
Enzymes [BR:avi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Avi_8187 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 TrkA_N Glu_dehyd_C AlaDh_PNT_C Sacchrp_dh_NADP Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ACM39647
UniProt: B9K3Z2
Position
pTiS4:131825..132874
Genome map
AA seq 349 aa AA seqDB search
MRAWLNKTHHSRLEAVEIATPDATGTQVVVDVTHCAVCHSDLHTWQGVTDYGSRGVLQRP
QPETPIAMGHEIVGKVSALGPDAQGVKIGDQVIVYPWLGCGKCNDCLNGRDNICAIGSRS
LGFMQHGGFADKVIVPHSKYLASTGNIDPALAATYACSGLTVRSAIRKIMPLAPEELVVV
IGAGGLGLQAVAMLRALTNNKILVLDKSEAKRDLVLGEGADHFVVLADEDTAARVIEING
GKVSSVLDFVNNSETSGLALSILRKGGRTIQVGLYGGELVVPLYTLAVTGLSIIGSITGT
PEDLKDVIRLAEEGVLKPIPLTRMAMAQVNEAMSRLEQGRVDGRIVLIN
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagggcctggctgaacaaaacacatcacagcaggttggaagccgtcgagatcgcaacg
cctgacgcgaccgggacacaggtcgtcgttgatgtgacgcactgcgcagtttgccattcg
gacctccacacttggcaaggagtgactgactacggaagccgtggcgttctgcagcgaccg
cagcctgaaacccctattgccatgggccatgaaatcgtgggcaaggtttccgcccttggg
ccggacgcacagggcgtgaagataggcgatcaggtaattgtctacccatggcttggctgc
gggaaatgcaacgattgcctcaacggtcgcgacaatatttgtgcaatcggtagccgtagc
cttggcttcatgcaacacggcggctttgccgataaggttatagtgcctcactcaaaatac
ctcgcctcgaccggcaacatcgacccggctttggcggcaacatacgcttgctccggcctg
accgtacggtcggcaattcgcaagataatgccactcgcgcctgaagagctcgtcgtcgtg
atcggtgcgggcgggctcggcctgcaagccgtcgccatgctgagggcgctgacgaataac
aagatcctcgtcctcgataaatctgaggctaagcgcgatctcgtgttgggggaaggcgcg
gatcatttcgtggttctcgccgacgaggacaccgcagccagggttatcgagatcaatggt
ggcaaggtcagctccgtgctcgatttcgtcaacaactcggaaacatccgggctggcctta
agtatcctgcgcaagggcggacggactatccaggtcggcctttacggcggtgaactggtc
gtcccgctctacacattggctgtgaccgggctttcgattatcggcagcatcactggaacg
ccggaagacctcaaagatgtcatcagactggctgaagagggcgttctgaagccgatccct
ttgacacggatggctatggctcaagtcaatgaagcgatgtcgcgtcttgagcagggccgg
gtcgacggccggatcgtactgattaactga

DBGET integrated database retrieval system