KEGG   Agrobacterium vitis: Avi_8210
Entry
Avi_8210          CDS       T00851                                 

Gene name
virD4
Definition
(GenBank) virA/G regulated protein
  KO
K03205  type IV secretion system protein VirD4 [EC:7.4.2.8]
Organism
avi  Agrobacterium vitis
Pathway
avi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:avi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Avi_8210 (virD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:avi02044]
    Avi_8210 (virD4)
Enzymes [BR:avi01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Avi_8210 (virD4)
Secretion system [BR:avi02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Avi_8210 (virD4)
SSDB
Motif
Pfam: T4SS-DNA_transf TraG-D_C TrwB_AAD_bind DUF1657
Other DBs
NCBI-ProteinID: ACM39656
UniProt: B9K401
Position
pTiS4:complement(150781..152772)
AA seq 663 aa
MMNSGKYTPIGLAAIIACSLAVGFCAASLYVTFRHGFTGEKMMTFSVFTFLYETPPYLGY
ASPTFYRGLAIIVVTSTVVLLGQLLLSMRDRQHHGTARWAGSSEMRHAKYLQRYSHVTGP
IFGKTCGPRWFGSYLSNGEQPHSLVVAPTRAGKGVGVVIPTLLTFKGSVIALDVKGELFE
LTSRARRSSGDAVFKFSPLDPERRTHCYNPVLDIAALPAERRFTETRRLAANLITAKGKG
AEGFIDGARDLFVAGILSCIERGTPTIGAVYDLFAQPGEKYKLFAQLAEETQNKEAQRIF
DNMAGNDTKILTSYTSVLGDGGLNLWADPLVKAATSRSDFSVYDLRRKKTCIYLCVSPND
LEVVAPLMRLLFQQVVSILQRSLPLGDERHDVLFLLDEFKHLGKLEAVETAITTIAGYKG
RFMFIIQSLSALTGTYDEAGKQNFLSNTGVQVFMATADDETPTYISKAIGDYTFQARSTS
YSQARMFDHNIQISEQGAPLLRAEQVRLLDDDHEIVLIKGQPPLKLRKVRYYSDLILKRL
FESQQGSLPEPASLRLPEDTNIFEGKLDQKAVDPISQKPVQIEESDYGKVVTPVSRPVAE
GEHSAVIEVRTGSNEVDDKHEYRGADAATSEELLDIAPALLAQRELLEQIISLQQRGGTD
SGT
NT seq 1992 nt   +upstreamnt  +downstreamnt
gtgatgaattcaggcaagtacacgccaataggcctagctgcgatcattgcatgttcactg
gccgttggtttttgtgcagcaagtctctatgtcacatttcgccatggatttacgggcgaa
aagatgatgactttcagcgtttttacgttcctgtacgagacaccaccttacttggggtac
gcaagccctacgttctaccgcggacttgccatcatcgtggtgacgtcgacagttgtgttg
ctaggccaactgttgttatcgatgcgcgatcgccaacatcacggcaccgctcgctgggcc
ggttcaagcgagatgcggcacgccaaatacctccagcgctacagtcacgtcacgggtccc
atattcggcaaaacatgcggaccgcgctggttcggtagctacctgagtaatggagaacaa
cctcacagtcttgttgttgccccaacccgcgctggtaagggcgtaggcgtcgttatcccg
acgttgctaacctttaagggctcagtaatcgctttggatgtgaaaggcgagctatttgaa
ctcacatcgagggcgcgcagatcaagcggcgacgccgttttcaagttctcgcccctagat
ccagagcggcgaacccactgttacaaccccgtgcttgatattgccgcgttgccggccgaa
cggcgctttacagaaacgcgtcgccttgctgcgaatctcatcacagccaaaggaaaggga
gcggagggtttcatcgacggcgcacgggatcttttcgtagcaggcatattgagttgtatt
gagcgcggcacaccaacgatcggcgcggtttacgacctgttcgctcagccgggcgaaaaa
tacaagctatttgcgcaactggcggaggaaacacaaaacaaagaggctcagcgaatcttc
gacaatatggccggaaatgacaccaaaatactgacgtcctacacatcggtgctcggcgac
ggcggcctcaatctttgggccgatccactcgttaaggcggctacaagccgctcggatttt
tccgtctacgatttgcggcggaaaaagacttgcatttatctttgtgtcagcccgaatgat
ctcgaagtcgtagcgccgttgatgcgtcttctcttccagcaggttgtatcaatcctgcag
cgatcgctgccccttggggatgaacggcacgatgttctatttctcctcgatgagttcaag
cacctgggcaagctggaagccgtagagacggcgattactacgatcgccggctacaagggc
cgcttcatgttcatcatacagagcctgtcggctttgaccggaacctatgatgaagctggt
aagcaaaatttcctcagcaatactggtgtgcaggtattcatggcgaccgctgatgacgag
acgccaacctacatttctaaagctatcggcgactacacgttccaagctcgctcgacttcg
tacagccaagcgcgcatgtttgatcacaacatccaaatctccgaacaaggagcgccgctt
ctgcgtgccgaacaggtccgcctactcgacgatgaccatgaaatagtccttatcaagggc
caacctccccttaaactgcgaaaagtgcgatattattcggatctcatattgaagcggctc
ttcgaaagccaacagggttcccttcccgagcccgcatctttgaggctgccggaagatacg
aacatcttcgaaggcaagcttgaccagaaagcagtcgatccaatatcgcaaaaaccggtg
cagattgaagagagcgactacgggaaagtcgttacccccgtaagcagacctgtggccgag
ggagagcacagcgcggtgatagaagttcgcaccggttcaaacgaagttgatgacaaacat
gaatacaggggcgcggacgccgcaacctccgaggagcttctggacattgctccagctctt
ctggcgcaacgcgaactccttgaacagatcatttctctccagcaacgaggtggaacagat
tccggcacttga

DBGET integrated database retrieval system