KEGG   Agrobacterium vitis: Avi_8333
Entry
Avi_8333          CDS       T00851                                 

Gene name
trbC
Definition
(GenBank) conjugal transfer protein
  KO
K20528  type IV secretion system protein TrbC
Organism
avi  Agrobacterium vitis
Pathway
avi02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:avi00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Avi_8333 (trbC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:avi02044]
    Avi_8333 (trbC)
Secretion system [BR:avi02044]
 Type IV secretion system
  Trb secretion system protein
   Avi_8333 (trbC)
SSDB
Motif
Pfam: TrbC Yip1
Other DBs
NCBI-ProteinID: ACM39743
UniProt: B9K489
Position
pTiS4:complement(256509..256913)
AA seq 134 aa
MSRKTHLILTVTALALVSLGSLDGALASSGGGSLPWESPLQQIQQSITGPVAGFIALAAV
AIAGAMLIFGGELNDFARRLCYVALVGGVLLGATQIVALFGATGASIGELHSQAGPFDYS
PSATLIERGEGNRG
NT seq 405 nt   +upstreamnt  +downstreamnt
atgtcgcgtaagacccatcttatcctcacagtcacagcactggccctcgtctcgctcggc
tcccttgatggggcactggcatcttccggtggcggcagccttccctgggaatccccactc
cagcagatccagcagtcgattaccggtcccgtggccggcttcatcgcacttgcggccgtc
gccatcgccggtgcgatgctgatcttcggcggggagctgaacgactttgcccgacggctt
tgctacgtcgcgctggtcggtggcgtgcttctcggcgccacccagatcgtcgccctgttt
ggcgcgacaggggcgtcgatcggcgagcttcattcgcaggctggcccgttcgattattcc
ccctccgccacgctcattgaaagaggggaggggaatcgtggctga

DBGET integrated database retrieval system