KEGG   Agrobacterium vitis: Avi_9659Help
Entry
Avi_9659          CDS       T00851                                 

Gene name
trbC
Definition
(GenBank) conjugal transfer protein
  KO
K20528  type IV secretion system protein TrbC
Organism
avi  Agrobacterium vitis
Pathway
avi02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:avi00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Avi_9659 (trbC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:avi02044]
    Avi_9659 (trbC)
Secretion system [BR:avi02044]
 Type IV secretion system
  Trb secretion system protein
   Avi_9659 (trbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbC E1-E2_ATPase
Motif
Other DBs
NCBI-ProteinID: ACM39360
UniProt: B9K3B2
Position
pAtS4b:complement(126301..126666)
Genome map
AA seq 121 aa AA seqDB search
MSRRMFTLVALAAISMMMAEPAFAAGGGGGLPWEGPLQQIQQSITGPVAMAIALIAVAVA
GGMLIFGGEINDFARRLAYVVLVCGILLGATQVVGLFGGGGASIGVPLEATQDVTLDRAH
G
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgtagaatgtttacgttggtcgcccttgcggccatctcgatgatgatggccgaa
ccggcctttgctgccgggggagggggtggtctgccctgggagggaccgcttcaacagatc
cagcagtccatcaccggccccgtcgccatggcaatcgccctgatcgcagtcgcggtcgca
ggtggcatgctcatctttggtggcgagatcaacgacttcgcgcgtcgtctcgcctacgtc
gttcttgtctgcggtatccttcttggcgcgacacaggttgtcggcctgttcggcggggga
ggggcgtcgattggcgttcctctcgaggcaacgcaggacgtgacgctggacagggcgcat
ggctga

DBGET integrated database retrieval system