KEGG   Azotobacter vinelandii CA: AvCA_02930Help
Entry
AvCA_02930        CDS       T02633                                 

Gene name
coaBC
Definition
(GenBank) bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
avl  Azotobacter vinelandii CA
Pathway
avl00770  Pantothenate and CoA biosynthesis
avl01100  Metabolic pathways
Module
avl_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:avl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AvCA_02930 (coaBC)
Enzymes [BR:avl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     AvCA_02930 (coaBC)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     AvCA_02930 (coaBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein NAD_binding_7 PALP
Motif
Other DBs
NCBI-ProteinID: AGK12545
Position
complement(275855..277063)
Genome map
AA seq 402 aa AA seqDB search
MQRLYRKRIVLGVGGGIAAYKSAELVRRLRDQGAQVHVVMTRGGREFITPLTLQALSGHP
VHLDLLDPAAEAAMGHIELAKWADLVLIAPATADLLARLAQGMADDLLTALVLATDAPVA
LAPAMNQAMWRDPATQANARTLAERGLRLFGPAEGSQACGDVGPGRMLEPAELAERAADC
FAGGRLTGRHVLITAGPTREDIDPVRYISNHSSGKMGFALAEAAAEAGARVTLVSGPVHL
PTPDRVERIDVISARDMLAACEAALPCDILIAAAAVADYRPQAVAPQKLKKSPDSDDGLI
LQLVRNPDILATLAQRADRPFSVGFAAETENLREYALRKLKTKNLDLIVANDVATPGIGF
NSEENAVSVIDRAQRETRFARTGKGKIARQLIAFIADRFDQA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggctgtatcggaaacgcatcgtcctgggcgtcggcggcggcatcgccgcctac
aagagcgcggagttggtccgccgcctgcgcgaccagggtgcgcaagtccacgtggtgatg
acccgggggggacgcgagttcatcacccccctgaccctccaggccctgtccggccatccg
gtgcacctggatctgctcgatccggccgccgaagcggcgatggggcatatcgaactggcc
aaatgggccgatctggtgctgatcgcgccggccaccgccgacctgctggcgcgcctggcc
cagggcatggccgacgacctgctgaccgccctggtgctggccaccgacgcgccggtggcc
ctggctccggcgatgaaccaggcgatgtggcgcgacccggcgacccaggccaacgcacgg
accctcgccgagcgcggtctgcgcctattcggtccggccgaaggcagccaggcctgcggc
gacgtcggcccgggacgcatgctggagcccgcggagctggccgaacgggccgccgactgc
ttcgcaggcggccgcttgaccggccgccacgtgctgatcaccgccggaccgacccgggaa
gacatcgacccggtgcgctacatcagcaaccacagctccggcaagatgggcttcgccctg
gccgaggccgccgccgaggccggcgcccgcgtcaccctggtcagcggcccggtgcacctg
ccgacgccggaccgggtcgaacgcatcgacgtgatcagcgcccgcgacatgctcgccgcc
tgcgaggcggcgctgccctgcgacattctcatcgccgccgccgcggtggccgactatcgc
ccgcaggccgtcgccccgcaaaaactgaagaagagcccggacagcgacgacggcctgatc
ctgcaactggtgcgcaacccggacattctcgctaccctggcgcagcgcgccgaccgcccg
ttcagcgtcggcttcgccgccgaaaccgaaaacctgcgggaatacgccctgcgcaagctg
aaaacgaaaaacctcgacctgatcgtcgccaacgacgtggccacccccggcatcggcttc
aacagcgaggaaaacgccgtcagcgtcatcgaccgcgcccagcgggaaacccgcttcgcc
cggaccggcaagggcaagatcgcccgccaactgatcgccttcatcgccgaccgcttcgac
caggcctga

DBGET integrated database retrieval system