KEGG   Azotobacter vinelandii CA: AvCA_05250Help
Entry
AvCA_05250        CDS       T02633                                 

Definition
(GenBank) D-galactarate dehydratase
  KO
K01708  galactarate dehydratase [EC:4.2.1.42]
Organism
avl  Azotobacter vinelandii CA
Pathway
avl00053  Ascorbate and aldarate metabolism
avl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    AvCA_05250
Enzymes [BR:avl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.42  galactarate dehydratase
     AvCA_05250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GD_AH_C SAF
Motif
Other DBs
NCBI-ProteinID: AGK15582
Position
502986..504539
Genome map
AA seq 517 aa AA seqDB search
MLIEHQDSPRYIRLHADDNVGVVVNDQGVAAGSRFADGLAAAEHIPQSHKVALADLAEGA
EVVRYGQVIGYALQPIPRGSWVTEAHLRMPEPPALDSLPRATQAVAPVEPLEGFTFEGFR
NPDGSVGTRNLLGVSTTVQCVAGVLEHCVERARKELLPKYPNVDDVIALSHSYGCGVAIN
APDAVIPIRTLFNLARNPNLGGQALVIGLGCEKLQPVQLMPGDALTSGMSEPQWLYRLQE
SGNGFAGMVGQILGLIEARLEVLDARRRETCPASELVVGMQCGGSDAFSGITANPALGVT
ADLLVRAGATVMFSENTEVRDGIHLLTPRAATPEVADALIREMDWYDRYLARGMADRSAN
TTPGNKKGGLNNIVEKAMGSIAKSGSSPIAGVVPPGEKVRGKGLQFCATPASDFICGTLQ
LAAGMNLHVFTTGRGTPYGLAMVPVIKVATRSELAERWPDLIDVDAGRVTSGRLSLEELG
GEIFRLYLDVASGRTRTWAERHRLHNDLVLFNPAPVT
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttgatcgaacatcaggactcgccgcgctacatccgcctgcacgcggacgacaacgtc
ggcgtggtggtcaacgaccagggcgtggcggccggcagccgcttcgccgacggtctcgcg
gcggccgagcacatcccgcagagccacaaggtggcgctggcggacctcgccgaaggcgcc
gaggtggtgcgctacggccaggtcatcggctacgccctgcagccgattccccgcggcagt
tgggtgaccgaggcgcacctgcgcatgcccgagccgccggcgctggacagcctgccgcgg
gcgacccaggccgtcgcgccggtggagccgttggaaggcttcaccttcgagggcttccgc
aaccccgacggcagcgtcggcacgcgcaacctgctcggcgtcagcaccaccgtgcagtgc
gtggccggggtgctcgagcactgcgtcgagcgggcgcgcaaggaactgctgccgaaatat
cccaacgtcgacgacgtgatcgccctgagccatagctacggctgcggcgtggcgatcaac
gcgccggacgcggtgatcccgatccgcaccctgttcaacctggcccgcaaccccaacctc
ggcggccaggcgctggtcatcggcctcggttgcgagaagctgcagccggtccagctgatg
ccgggcgacgcgctgaccagcgggatgagcgagccgcagtggctgtaccgcctgcaggag
tcgggcaacggcttcgccgggatggtcgggcagatcctcggcctgatcgaggcgcgcctc
gaggtgctcgacgcgcggcgccgcgagacctgcccggcctccgagctggtggtcggcatg
cagtgcggcggcagcgacgccttctccgggatcaccgccaacccggcgctgggcgtcacc
gcggacctcctggtgcgcgccggcgccaccgtgatgttctcggagaacaccgaggtgcgc
gacggcatccacctgctcaccccgcgggcggctacgcccgaggtggccgacgcgctgatc
cgcgagatggactggtacgaccgctacctggcgcgggggatggccgaccgcagcgccaac
accactcccggcaacaagaagggcgggttgaacaacatcgtcgagaaagccatgggctcg
atcgccaagtccggctccagcccgatcgccggcgtggtcccgccgggcgagaaggtccgg
ggcaagggcctgcagttctgcgccaccccggccagcgacttcatctgcggcaccctgcaa
ctggccgccggaatgaacctgcacgtcttcaccaccgggcgcggcaccccctacggcctg
gcgatggtgccggtgatcaaggtggccacccgcagcgagctggccgagcgctggccggac
ctgatcgacgtggacgccggaagggtgacctcggggcggctgtcgctggaggaactgggc
ggggagatcttccggctctacctggacgtggccagcggccgcacgcggacctgggccgag
cggcatcgcctgcacaacgatctggtgctgttcaatccggcgccggtaacctga

DBGET integrated database retrieval system