KEGG   Azotobacter vinelandii CA: AvCA_16440Help
Entry
AvCA_16440        CDS       T02633                                 

Definition
(GenBank) acetyl-CoA hydrolase/transferase family
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
avl  Azotobacter vinelandii CA
Pathway
avl00020  Citrate cycle (TCA cycle)
avl00620  Pyruvate metabolism
avl00650  Butanoate metabolism
avl01100  Metabolic pathways
avl01110  Biosynthesis of secondary metabolites
avl01120  Microbial metabolism in diverse environments
avl01130  Biosynthesis of antibiotics
avl01200  Carbon metabolism
Module
avl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
avl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:avl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AvCA_16440
   00620 Pyruvate metabolism
    AvCA_16440
   00650 Butanoate metabolism
    AvCA_16440
Enzymes [BR:avl01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     AvCA_16440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans CitF LUD_dom
Motif
Other DBs
NCBI-ProteinID: AGK15253
Position
1629112..1630608
Genome map
AA seq 498 aa AA seqDB search
MYSERIRLVSLHDRIMSAEQAAALIEDGMTVGMSGFGGAGDAKAIPAALVERAGRDPLKI
NLITGASLGKGLDGLMAEAGLLARRMPFQGDPVLRRAINAGEVAFIDQHLSEVVEQMRDG
HIPTPDVAVVEAVAITERGHIVPTSSVGNSASLALAAKRVIVELNLGCNPLLEGLHDIHV
PADRPDRQPIPLVRVDDRIGTPAIEIDPAKIAAIVICDTPETAYPMLPPDDETQAIANHL
IGFFEREVARGRLAGNLAPLQVGVGSIANAVMHGLIESSFSDLTLYSEVLQDSAFALFDA
GRLRFASGCSITLSEDCGRRVFAELGKYRERLVLRPQEISNHPEVARRLGIIGINTALEF
DIYGNVNSTHVGGTRMMNGIGGSGDFTRNARLAIFVTKSIAKDGAISSVVPMVSHVDHTE
HDVDILVTEQGLADLRGLAPRERARAIIDNCVHPDYHAALEDYFERASRRGGQTPHLLGE
ALSWHLNLEERGHMLKAI
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtattccgagcgtattcgcctggtttccctgcacgaccgaatcatgagcgccgagcag
gcggcggccctgatcgaggacggcatgaccgtcggcatgagcggcttcggcggagcgggc
gacgccaaggccattccggctgcgctggtcgagcgggcggggcgcgatcctctcaagatc
aacctgatcaccggcgccagcctcggcaagggactggacggcctgatggccgaggccggg
ctgctcgcccggcgcatgcctttccagggcgaccccgtcctgcgccgggcgatcaacgcc
ggcgaggtcgcgttcatcgaccagcatctgtcggaagtcgtcgagcagatgcgcgacggc
catatcccgacgccggatgtcgccgtggtcgaagcggtggccatcaccgagcgggggcac
atagtgccgacctcctcggtgggcaattcggccagcctggccctggccgcgaagcgggtg
atcgtcgagctcaatctcggctgcaatccgctgctggaagggctgcatgacatccacgtc
ccggcggatcgcccggatcgccagccgattcccctggtccgggtcgacgatcgcatcggc
acgccggccatcgagatcgatccggcgaagatcgccgccatcgtcatctgcgatacgccc
gagacggcttacccgatgctgccgccggacgacgagacccaggccatcgccaaccacctg
atcggcttcttcgagcgggaggtggcgcgcgggcggctggccggcaacctggcgccgctg
caggtcggcgtcggctccatcgccaacgcggtgatgcacggcctgatcgagtcgtcgttc
agcgatctgacgctgtattccgaggtattgcaggattcggccttcgcgctgttcgacgcc
ggccggctgaggttcgcctccggctgttcgatcaccctgtcggaagactgcggccggcgt
gtcttcgccgagctgggcaagtaccgggagcgtctggtcctgcgcccgcaggagatttcc
aaccatccggaagtggcccgccgcctcggcatcatcggcatcaacaccgccctggagttc
gacatctacggcaacgtcaactccactcacgtgggcggcacgcggatgatgaacggcatc
ggcggctccggcgacttcacccgcaacgcgcgcctggcgatcttcgtcaccaagtccatc
gccaaggacggggccatttccagcgtggtgccgatggtcagccacgtcgaccacaccgag
cacgatgtcgacatcctggtcaccgagcagggcctggccgacctgcgcggcctggcgccg
cgcgaacgggcgcgggcgatcatcgacaactgcgtgcatccggactaccacgccgcgctg
gaggactacttcgagcgcgccagccggcgcggcgggcagactccgcatctcctgggcgag
gcgctgtcctggcatctcaacctggaagagcgcggccacatgctgaaggccatctga

DBGET integrated database retrieval system