KEGG   Azotobacter vinelandii CA: AvCA_17360Help
Entry
AvCA_17360        CDS       T02633                                 

Definition
(GenBank) Acetyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
avl  Azotobacter vinelandii CA
Pathway
avl00071  Fatty acid degradation
avl00072  Synthesis and degradation of ketone bodies
avl00280  Valine, leucine and isoleucine degradation
avl00310  Lysine degradation
avl00362  Benzoate degradation
avl00380  Tryptophan metabolism
avl00620  Pyruvate metabolism
avl00630  Glyoxylate and dicarboxylate metabolism
avl00640  Propanoate metabolism
avl00650  Butanoate metabolism
avl00900  Terpenoid backbone biosynthesis
avl01100  Metabolic pathways
avl01110  Biosynthesis of secondary metabolites
avl01120  Microbial metabolism in diverse environments
avl01130  Biosynthesis of antibiotics
avl01200  Carbon metabolism
avl01212  Fatty acid metabolism
avl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:avl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AvCA_17360
   00630 Glyoxylate and dicarboxylate metabolism
    AvCA_17360
   00640 Propanoate metabolism
    AvCA_17360
   00650 Butanoate metabolism
    AvCA_17360
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AvCA_17360
   00072 Synthesis and degradation of ketone bodies
    AvCA_17360
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AvCA_17360
   00310 Lysine degradation
    AvCA_17360
   00380 Tryptophan metabolism
    AvCA_17360
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AvCA_17360
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AvCA_17360
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AvCA_17360
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:avl04147]
    AvCA_17360
Enzymes [BR:avl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AvCA_17360
Exosome [BR:avl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AvCA_17360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGK15204
Position
1721097..1722278
Genome map
AA seq 393 aa AA seqDB search
MNDAVIVSTARTALTKSWRGAFNMTHPVTLGGHVVEQAILRAGIEPGEVEDVIMGSTFLE
GPAGMNMARQIALRAGCPVTTGGLTINRFCSTGLQSIVLAAQRVIAGEGDVYVAGGVESI
SLVQNDANFALLQEAWIRQHRPAVHWDMLRTAETVAARYGIGREAQDRYGVDSQLRAAAA
QAEGRYAEEIAPLTTVMGVFERDSGHFARREITVSRDEGIRPDTTYESVAAIPSVVPGGV
IAAGNASQFSDGASACVVMNAGLAERRGLQPLGLFLGFAVAGCEPDEMGVGPVHAVPRLL
RQTGLGVDDIGLWELNEAFAVQVLYCRDRLGIDERRLNVNGGAIALGHPYGMSGSRLVGH
ALIEGRRRGVKYVVVTMCIGGGMGAAGLFEVLP
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacgccgtgatcgtttcgactgcgcgtaccgccctcaccaagtcctggcggggc
gctttcaacatgacccatcccgtgaccctcggcggacatgtcgtggaacaggccatcctg
cgcgccggcatcgagccgggcgaagtggaggatgtgatcatgggctcgaccttcctggaa
gggccggcggggatgaatatggcccgccagatcgccctgcgtgccggctgcccggtgacc
accggcggcctgaccatcaaccgcttctgttccaccgggctgcagagcatcgttctcgcc
gcgcagcgggtgatcgccggcgaaggcgacgtctacgtggccggcggcgtggagtcgatt
tccctggtgcagaacgacgccaacttcgcgctccttcaagaagcctggatccgccagcac
aggccggcggtgcactgggacatgctgcgcaccgcggaaaccgtcgccgcccgctacggc
atcggccgcgaagcgcaggaccgctacggcgtcgacagccagttgcgggccgccgccgcc
caggccgaagggcgctatgccgaggaaatcgcgccgctgaccaccgtcatgggcgtgttc
gagcgcgacagcgggcatttcgcccgccgggaaatcacggtttcccgcgacgagggcatc
cggcccgacaccacctacgagtccgtcgccgccattccgtccgtggtgccgggcggggtg
atcgccgcgggcaacgccagccagttctccgacggggcttccgcctgcgtcgtcatgaac
gcgggcctggccgaacggcgcggcctgcagcctctgggcctgttcctgggcttcgcggtc
gccggctgcgagccggacgaaatgggtgtcggcccggtccatgcggtgcccaggctgctc
aggcagaccggcctgggcgtcgacgacatcgggctctgggaactcaacgaagccttcgcg
gtgcaggtactttactgccgcgaccgcctgggcatcgacgagcggcgcctgaacgtcaat
ggcggagcgatcgccctgggacatccctacggcatgtccggctcgcgtctggtcggccac
gcgctgatcgagggacgccgccgcggcgtgaaatacgtggtggtgaccatgtgcatcggc
ggtggcatgggcgccgcgggactcttcgaggtgctgccatga

DBGET integrated database retrieval system