KEGG   Azotobacter vinelandii CA: AvCA_34560Help
Entry
AvCA_34560        CDS       T02633                                 

Gene name
ackA-1
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
avl  Azotobacter vinelandii CA
Pathway
avl00430  Taurine and hypotaurine metabolism
avl00620  Pyruvate metabolism
avl00640  Propanoate metabolism
avl00680  Methane metabolism
avl01100  Metabolic pathways
avl01120  Microbial metabolism in diverse environments
avl01200  Carbon metabolism
Module
avl_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:avl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AvCA_34560 (ackA-1)
   00640 Propanoate metabolism
    AvCA_34560 (ackA-1)
  09102 Energy metabolism
   00680 Methane metabolism
    AvCA_34560 (ackA-1)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    AvCA_34560 (ackA-1)
Enzymes [BR:avl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     AvCA_34560 (ackA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AGK12443
Position
complement(3532410..3533597)
Genome map
AA seq 395 aa AA seqDB search
MSARNILVINCGSSSIKFALVNEAQTTFPLQGLAERLGSPEAVIHWQFGDVKETLSLPGA
DHQVALGEILPLAQEAAGGRLSGIGHRVVHGGEHFTDARLIDESVIEGIRTSAQLAPLHN
PAHLIGIAATMSLFPDLPQVSVFDTAFHQTMPPHAYRYAVPEFLYKEHGVRRYGFHGTSH
RYVSKRAAEMAGLPVEDSAWLSAHLGNGCSTCAIVNGESRDTSMGLTPLEGLVMGTRSGD
VDPNLHSYLERTLGWTIEQVDRMLNNDSGLKGLSGLSNDMRTLSEACLSGHPGAVLAFEV
FCYRLAKSLAGMACALPRLNGLIFTGGIGENSAAVRERTVEHLKLFGFQLDAEANARCTR
GLAGEIQAAGSPRVIVVPTNEERQIALDTLALLDA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcccgcaatattctggtgatcaactgcggtagttcatcaatcaagttcgccctg
gtcaacgaagcgcagacgacctttcccctgcaggggctggccgagcgtctcggcagtccg
gaagcggtcatccactggcagttcggcgatgtcaaggaaaccctcagcctgccgggcgcc
gaccatcaggtggcgctgggcgagatcctgccgctggcccaggaggccgccggtggccgg
ctcagcggcatcggccaccgcgtggtccatggcggcgagcatttcaccgatgcccgcctg
atcgacgagtcggtgatcgaaggcatacgcaccagcgcccagttggcaccgctgcacaac
ccggcccatctgatcggcatcgccgcgaccatgtcgctgttccccgacctgccgcaggtc
agcgtgttcgataccgccttccaccagaccatgccgccccatgcctaccgctatgccgtg
ccggaattcctgtacaaggaacatggcgtgcgccgctacggctttcatggcaccagccac
cgctacgtcagcaagcgggccgccgagatggccggcctgccggtggaagacagcgcctgg
ctgtcggcccatctgggcaacggctgctccacctgcgccatcgtcaacggcgagagccgc
gacaccagcatgggcctgactcccctggagggcctggtgatggggacccgcagcggcgac
gtcgaccccaacctgcacagctatctggagcgcaccctgggctggaccatcgagcaggtc
gaccgcatgctcaacaacgacagcggcctgaaggggctgtccggcctgtccaacgacatg
cgcaccctgtccgaggcctgcctgagcggccaccccggcgccgtcctggccttcgaggtg
ttctgctaccgcctggccaagtcgctggccggcatggcctgcgccctgcccaggctgaac
ggtctgatcttcaccggcggcatcggcgagaactcggccgccgtgcgcgagcgcaccgtg
gagcacctgaagctgttcggcttccagctcgatgccgaagccaacgcccgttgcacccgt
ggcttggccggcgagatccaggcggccggcagcccgcgcgtcatagtggtgccgaccaac
gaggagcgccagatcgccctggacaccctcgccctgctcgacgcctga

DBGET integrated database retrieval system