KEGG   Azotobacter vinelandii DJ: Avin_03550Help
Entry
Avin_03550        CDS       T00885                                 

Gene name
metF
Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
avn  Azotobacter vinelandii DJ
Pathway
avn00670  One carbon pool by folate
avn01100  Metabolic pathways
avn01120  Microbial metabolism in diverse environments
avn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:avn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Avin_03550 (metF)
Enzymes [BR:avn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     Avin_03550 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: ACO76615
UniProt: C1DIB8
Position
complement(334820..335665)
Genome map
AA seq 281 aa AA seqDB search
MSQERRYSFEFFPTKTEAGHEKLMNVARRLAGCDPDFFSCTYGAGGSTRDRTLNTVLQLD
GEVKVPTAPHLSCVGDSRAELRSLLNTYKDAGIRRIVALRGDLPSGMGLANGELRHASDL
VEFIRAETGGHFHIEVAAYPEMHPQARNLEDDLARFAAKMKAGADSAITQYFFNADSYFH
FVERVRKLGVEQPIVPGIMPITNYSKLARFSDACGAELPRWVRKQLEAYGDDLESIQAFG
EQVVTAMCEKLLEGGAPGLHFYTLNQAEPSLAIWNNLGLPR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaggaacgccgctacagcttcgagttcttcccgaccaagaccgaggccggccac
gaaaaactgatgaacgtggcccgccgactggccggctgcgaccccgacttcttctcctgc
acctacggcgccggcggctcgacccgcgaccgaaccctgaacaccgtgctgcaactggac
ggcgaggtgaaggtaccgaccgcgccgcacctgtcctgcgtcggcgacagcagggccgaa
ctgcgcagcctgctgaacacctacaaggacgccggcatccgccgcatcgtcgccctgcgc
ggcgacctgccgtccggcatgggcctggccaacggcgagctgcgccacgccagcgacctg
gtggaattcatccgcgccgaaaccggcgggcacttccacatcgaggtcgccgcttacccg
gagatgcacccgcaggcgcgcaacctcgaggacgacctcgcccgcttcgccgccaagatg
aaggccggagcggacagcgccatcacccagtacttcttcaacgccgacagctatttccat
ttcgtcgagcgggtccgcaagctgggcgtggaacagccgatcgtccccggcatcatgccg
atcaccaactacagcaagctggcgcgcttctccgatgcctgcggcgcggaactgccgcgc
tgggtgcgcaagcaactggaggcctacggcgacgacctggaaagcatccaggccttcggc
gaacaggtggtgaccgcgatgtgcgagaaactcctcgaaggcggcgcgccgggcctgcac
ttctatactctgaatcaggccgaacccagcctggcgatctggaacaacctcgggctgccg
cgctga

DBGET integrated database retrieval system