KEGG   Azotobacter vinelandii DJ: Avin_05920Help
Entry
Avin_05920        CDS       T00885                                 

Gene name
glcB
Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
avn  Azotobacter vinelandii DJ
Pathway
avn00620  Pyruvate metabolism
avn00630  Glyoxylate and dicarboxylate metabolism
avn01100  Metabolic pathways
avn01110  Biosynthesis of secondary metabolites
avn01120  Microbial metabolism in diverse environments
avn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Avin_05920 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    Avin_05920 (glcB)
Enzymes [BR:avn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Avin_05920 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ACO76845
UniProt: C1DKI2
Position
complement(572615..574789)
Genome map
AA seq 724 aa AA seqDB search
MTERVQVGGLQVAKVLYDFINAEAVPGTGVDVAAFWAGAADVIHDLAPKNRALLAKRDEL
QAKIDAWHRARAGQGHDAVAYKTFLQEIGYLLPEPEDFAATTENVDDEIARMAGPQLVVP
IMNARFALNAANARWGSLYDALYGTDAIPEAGGAEKVQGYNKVRGDKVIALARAFLDEAA
PLEGTSHAAATGYRIDGGKLVVALEGGSATGLKNPAQLVGFQGEAAAPKAVLLKHNGIHF
EIQIDPQSPIGKTDAAGVKDVLMEAALTTIMDCEDSVAAVDADDKVIAYRNWLGLMKGDL
AEQVSKGGSTFTRTMNPDREYTAAGGGALTLHGRSLLFVRNVGHLMTNDAILDKDGNEVP
EGIQDALFTGLIALHDLKGDTSRRNSRAGSVYIVKPKMHGPEEVAFTNELFGRVEGVLGL
TRNTLKVGIMDEERRTTVNLKACIKAARERVVFINTGFLDRTGDELHTSMEAGPMIRKGE
MKNATWIKAYENWNVDIGLATGLSGRAQIGKGMWAMPDLMAAMLEQKIGHPLAGANTAWV
PSPTAATLHALHYHKVDVFARQRELAKRKRASLDDILSIPLAPNTDWSAAEIQQELDNNA
QGILGYVVRWIDQGVGCSKVPDINDIGLMEDRATLRISSQHIANWLRHGVCSLEQVMETF
KRMALVVDRQNAGDPLYRPMAPDFDGVAFQAAVELCVEGTRQPNGYTEPVLHRRRREFKA
KNAL
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcgcgttcaagtcggcggcctgcaagtcgccaaagtcctgtatgacttcatc
aatgccgaagccgtccccggcaccggcgtcgatgtcgccgccttctgggccggcgccgcc
gatgtcatccacgacctggcgccgaagaaccgcgccctgctggccaagcgcgacgaactg
caggcgaagatcgacgcctggcaccgggcccgtgccggccagggccacgacgccgtggcc
tacaagaccttcctgcaggagatcggctacctgttgccggaacccgaggatttcgccgcc
accaccgagaacgtcgacgacgagatcgcccgcatggccggtccgcaactggtggtgccg
atcatgaacgcgcgtttcgccctgaacgccgccaacgcccgctggggctcgctgtacgac
gcgctgtacggcaccgacgcgatccccgaagcgggtggcgccgagaaagtccaaggctac
aacaaggttcgcggcgacaaggtcatcgccctcgcccgcgccttcctcgacgaggccgca
ccgctggaaggcacctcccatgccgccgccaccggctatcgcatcgacggcggcaagctg
gtcgtcgccctcgaaggcggcagcgccaccggcctgaagaacccggcccaactggtcggc
ttccagggcgaggcggccgcgcccaaggccgtgctgctcaagcacaacggcatccacttc
gagatccagatcgacccgcagagcccgatcggcaagaccgacgccgccggcgtgaaggac
gtgctgatggaggccgccctgaccaccatcatggactgcgaggactcggtggccgccgtc
gacgccgacgacaaggtcatcgcctaccggaactggctgggcctgatgaagggcgacctg
gccgagcaggtcagcaagggcggcagcaccttcacccgcaccatgaacccggaccgcgag
tacaccgcggcgggcggcggcgccctgaccctgcacggtcgctccctgctgttcgtgcgc
aacgtcggccacctgatgaccaacgacgcgatcctcgacaaggacggcaacgaagtgccg
gaaggcatccaggacgcgctgttcaccggcctgatcgccctgcacgacctcaagggcgac
accagccgccggaacagccgcgccggctccgtgtacatcgtcaagccgaagatgcacggc
cccgaggaagtcgccttcaccaacgagctgttcggccgcgtcgagggcgtcctcggcctg
acccgcaataccctcaaggtcggcatcatggacgaggagcgccgcaccacggtcaacctc
aaggcctgcatcaaggccgcccgcgagcgcgtggtgttcatcaacaccggcttcctcgac
cgcaccggcgacgaactacacacatccatggaagccggcccgatgatccgcaagggcgag
atgaaaaacgccacctggatcaaggcctacgagaactggaacgtcgacatcggcctggcc
accggcctgtccggccgcgcgcagatcggcaagggcatgtgggccatgcccgatctgatg
gccgccatgctcgagcagaagatcggccatccgctggccggcgccaacaccgcctgggta
ccgtcgccgaccgccgccaccctgcacgccctgcactaccacaaggtcgacgtgttcgcc
cgccagcgggagctggccaagcgcaagcgcgcctcgctggacgacatcctgagcatcccg
ctggcgccgaacaccgactggagcgccgccgagatccagcaggagctggacaacaacgcc
cagggcatcctcggctacgtggtgcgctggatcgaccagggcgtcggctgctccaaggtc
ccggacatcaacgacatcggcctgatggaagaccgcgccaccctgcgtatctccagccag
cacatcgccaactggctgcgccacggcgtgtgcagcctcgagcaggtgatggaaaccttc
aagcgcatggccctggtggtggaccgccagaacgccggcgacccgctgtaccgtccgatg
gcgccggacttcgacggcgtcgccttccaggccgccgtcgagctgtgcgtcgaaggcacc
aggcagcccaacggctacaccgagccggtgctgcaccgccgccgccgcgaattcaaggcc
aagaacgctctctga

DBGET integrated database retrieval system