KEGG   Azotobacter vinelandii DJ: Avin_12710Help
Entry
Avin_12710        CDS       T00885                                 

Definition
(GenBank) hydrolase, carbon-nitrogen family
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
avn  Azotobacter vinelandii DJ
Brite
KEGG Orthology (KO) [BR:avn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Avin_12710
Enzymes [BR:avn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     Avin_12710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ACO77497
UniProt: C1DQ45
Position
1239009..1239857
Genome map
AA seq 282 aa AA seqDB search
MNVAVLQMVSQDDVPANLATARRLLEQAAIGGARLAVLPENFAALGRRDSAALARAEAEG
QGPVLPCLRQAARDFGLWIVAGTLPLPPDGRPWAKAHACSLLFDEHGEQVARYDKLHLFD
VDVADQRGRYRESDDYAHGERIVVADTPAGRLGLSVCYDLRFPELYAALRDAGAELISAP
SAFTAVTGGAHWHVLVRARALETQCYLLAAAQGGLHPGPRETYGHSVIVDPWGRPLAEQA
QGEGVLLARRDADEQAAIRQRMPVQRHRRFSVSAVPRPIEME
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtggcggtattgcagatggtcagccaggacgatgtgccggccaacctcgcgacc
gcgcgccgtctgctcgagcaggccgctatcgggggcgcgcgccttgccgttctgccggag
aacttcgccgccctgggtcggcgcgatagcgctgccctggcccgtgccgaggccgaaggg
caagggccggtgctgccctgcctgcgccaggcggcccgtgatttcggcctgtggatagtc
gcgggtaccctgccgctgccgccggacggccggccgtgggccaaggcccatgcctgttcg
ctgttgttcgacgagcatggcgagcaggtggctcgctacgacaagctgcacctgttcgac
gtggacgtggccgaccagcgcggacgctaccgcgaatcggacgactatgcccatggtgag
cggatcgtggtggcggataccccggccggtcggctcggtctgtcggtctgctacgacctg
cgcttccccgagctctatgccgccctgcgcgatgccggggccgagctgatcagcgctccc
tcggccttcacggcggtgaccggcggcgcccactggcatgtgctggtgcgtgcgcgtgcg
ctggaaacccagtgctatctgctggcggccgcccaggggggcctgcatcccggcccccgg
gaaacctacggccattcggtcatcgtcgatccctgggggcggccgttggccgagcaggcg
cagggcgagggcgtactgctggcccgccgggatgccgacgagcaggcggcgatccgtcag
cgtatgccggtgcagcgccatcggcgattttcagtgtcggccgtgccgcggccgatcgaa
atggagtga

DBGET integrated database retrieval system