KEGG   Azotobacter vinelandii DJ: Avin_14540Help
Entry
Avin_14540        CDS       T00885                                 

Definition
(GenBank) beta-N-acetyl-D-glucosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
avn  Azotobacter vinelandii DJ
Pathway
avn00520  Amino sugar and nucleotide sugar metabolism
avn01100  Metabolic pathways
avn01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Avin_14540
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Avin_14540
Enzymes [BR:avn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Avin_14540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: ACO77670
UniProt: C1DQZ7
Position
1433614..1434597
Genome map
AA seq 327 aa AA seqDB search
MLDIAGTWLTAEDRQLLRQPEVGGLILFARNIEHPAQVRELCAAIRAERPDLLLAVDQEG
GRVQRLRQGFVRLPAMGALAAHGEDERLAEECGWLMATEVLAAGLDFSFAPVLDLDHGRS
AVIGSRGFAGEPEAVVRLAGAFVRGMHAAGMAATGKHFPGHGWAEADSHVAIPTDERSLD
AIRAQDLLPFQRLGGQLDALMPAHVIYSQVDEQPAGFSRRWLQDILRGELGFGGVVFSDD
LSMAGAHVAGDAAARIEAALAAGCDIGLVCNDRAAAELALSALQRLDAKPSPRLAGMRRR
AFPGVDYKQNPRWLRALESLRQARLID
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgctggacatcgccggcacctggctgaccgccgaggatcgccagttgctgcgccagccc
gaggtaggcggcctgattctgttcgcccgcaatatcgagcacccggcccaggtccgcgaa
ctctgcgcggcgatccgtgccgagcgccccgacctgctgctcgccgtggatcaggagggc
ggccgtgtgcaacgcctgcgccagggtttcgtgcgtttgccggcgatgggggcgctggcc
gcacatggggaggacgaacggctggccgaggagtgcggctggctgatggcgaccgaggtg
ctggcagccgggctggatttcagtttcgcgccggtgctggatctcgatcatgggcgtagc
gcggtgatcggctcgcgcggcttcgccggcgaaccggaggcggtcgtccgcctggccggg
gccttcgtccgtggcatgcatgccgccggcatggccgctactggcaagcatttccccggc
catggctgggcggaagccgattcccatgttgccatccccaccgacgagcgcagtctcgat
gcgatccgcgctcaggatctgctgcccttccagcgcctcggcggccaactggatgcgctg
atgccggcgcacgtcatctattcgcaggtcgatgagcagccggccggcttctcccgccgc
tggctgcaggacatcctgcgcggcgagctgggcttcggcggggtggtgttcagcgacgac
ctgtcgatggccggcgcccatgtggccggcgatgcggccgcacggatcgaggcggcgctc
gccgccggttgcgacataggactggtatgcaacgaccgggcggcggccgaactggccctg
tccgccctgcagcgcctcgacgcgaagccgtcgccgcgcctggcggggatgcgccggcga
gccttccctggcgtcgattacaagcagaacccacgctggctgcgcgcgctcgagagtctg
cgccaggcccggctgatcgattga

DBGET integrated database retrieval system