KEGG   Azotobacter vinelandii DJ: Avin_14580Help
Entry
Avin_14580        CDS       T00885                                 

Gene name
gapB
Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
avn  Azotobacter vinelandii DJ
Pathway
avn00010  Glycolysis / Gluconeogenesis
avn01100  Metabolic pathways
avn01110  Biosynthesis of secondary metabolites
avn01120  Microbial metabolism in diverse environments
avn01130  Biosynthesis of antibiotics
avn01200  Carbon metabolism
avn01230  Biosynthesis of amino acids
Module
avn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
avn_M00002  Glycolysis, core module involving three-carbon compounds
avn_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
avn_M00552  D-galactonate degradation, De Ley-Doudoroff pathway, D-galactonate => glycerate-3P
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Avin_14580 (gapB)
Enzymes [BR:avn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     Avin_14580 (gapB)
Membrane trafficking [BR:avn04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Avin_14580 (gapB)
Exosome [BR:avn04147]
 Exosomal proteins
  Proteins found in most exosomes
   Avin_14580 (gapB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N
Motif
Other DBs
NCBI-ProteinID: ACO77674
UniProt: C1DR01
Position
1439606..1440991
Genome map
AA seq 461 aa AA seqDB search
MIPLIGQLYRNNNVVTSIFGRPLINQSVIAVLKAHRFARHRQTDEAELSVHETFPILKAM
SELKLGAASVDLGKMVGKYREAGAGRSVEQFVRDELSEVVGRQNSIQHKGSDVVLYGFGR
IGRLLARILIQKTGGGDGLRLRAIVVRKGADNDLAKRASLLRRDSVHGPFEGTITVDEES
NTILANGNLIQVIYSNDPTSVDYTQYGIQSAIVVDNTGKWRDAEGLGQHLKCPGVARVVL
TAPGKGALKNIVHGINHRDITDEDKIVSAASCTTNAIVPVLKAVNDKFGIVNGHVETVHS
YTNDQNLIDNFHKGSRRGRSAPLNMVITETGAATAAAKALPELKGKLTGNAIRVPTPNVS
MAILNLNLEKSTSRDEINEYLRQVAMFSELHKQIDFVNSSEVVSTDFVGSRHAGVVDAEA
TICTDNRVVLYVWYDNEFGYSCQVVRVLEEIAGVNPPVFPN
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgatcccgctgatcggtcagctctatcgcaacaacaacgtggtgacctcgattttcgga
cgtcccctgatcaaccagtccgtgatcgcggtcctcaaggcccatcgcttcgcccgccac
cgccagaccgacgaggccgagctttcggtgcacgagaccttcccgatcctcaaggccatg
agcgagctgaagctcggcgccgcttccgtcgatctgggcaagatggtcggcaagtaccgg
gaggccggtgccggtcgctccgtcgagcagttcgtgcgcgacgagctgtccgaggtcgtc
ggcaggcagaacagcatccagcacaagggcagcgacgtggtgctctatggcttcggccgc
atcggccgcctgctggcgcgcatcctgatccagaagaccggcggcggcgacggactgcgc
ctgcgcgccatcgtcgtgcgcaagggcgccgacaacgatctggccaagcgcgccagcctg
ttgcgccgtgactcggtgcacggcccgttcgaaggcaccatcaccgtggacgaggaaagc
aataccatcctcgccaacggcaacctgatccaggtgatctactccaacgacccgacctcc
gtcgattacacccagtacggcatccagagcgccatcgtggtcgacaacaccggcaagtgg
cgcgacgccgaaggcctcggccagcatctgaagtgcccgggcgtcgcccgcgtggtactg
accgctccgggcaagggggcgctgaagaacatcgtgcatggcatcaaccatcgcgacatc
accgacgaggacaagatcgtctccgcggcttcctgcaccaccaatgccatcgtgccggtg
ctgaaggcggtgaacgacaagttcggcatcgtcaatggtcacgtggagaccgtgcactcc
tacaccaacgaccagaacctgatcgacaacttccacaagggcagccgccgcggtcgaagc
gctccgctgaacatggtgatcaccgagaccggggcggccaccgccgcggccaaggccctg
cccgagttgaagggcaagctgaccggcaacgcgattcgcgtgccgacgccgaacgtttcc
atggcgatcctcaacctgaacctggaaaagtccaccagccgcgacgagatcaacgaatac
ctgcgtcaggtggcgatgttctccgaactgcacaagcagatcgacttcgtcaactcgtcc
gaggtggtatccaccgacttcgtcggttcccgccatgccggggtggtggatgccgaagcc
accatctgcaccgacaatcgagtcgtgctctatgtctggtacgacaacgagttcggctac
agttgccaggtggtacgcgtgctcgaggaaatagccggagtcaatccgccggttttcccc
aactga

DBGET integrated database retrieval system