KEGG   Azotobacter vinelandii DJ: Avin_16240
Entry
Avin_16240        CDS       T00885                                 

Gene name
eexD
Definition
(GenBank) Type I secretion system ATPase
  KO
K16299  ATP-binding cassette, subfamily C, bacterial EexD
Organism
avn  Azotobacter vinelandii DJ
Pathway
avn02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:avn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Avin_16240 (eexD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:avn02000]
    Avin_16240 (eexD)
   02044 Secretion system [BR:avn02044]
    Avin_16240 (eexD)
Transporters [BR:avn02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    Avin_16240 (eexD)
Secretion system [BR:avn02044]
 Type I secretion system
  AlgE-type Mannuronan C-5-Epimerase transporter
   Avin_16240 (eexD)
SSDB
Motif
Pfam: ABC_tran ABC_membrane SMC_N AAA_21 AAA_25 AAA_29 AAA_16 AAA_33 ABC_ATPase MMR_HSR1 AAA_18 Zeta_toxin
Other DBs
NCBI-ProteinID: ACO77839
UniProt: C1DS84
Position
1603822..1605564
AA seq 580 aa
MRNVRENSLQAALKICKGSFISVGFFSFFVNALMLVPSFYMLQVYGRVLTSGSITTLLML
TLIMTALMVTMGSLEWTRSRIMVRISSRLDALLGRDVYRASFKRALDSGGMDASAQPLND
LTGLRQFLTGAGLFAFFDAPWLPVYIGVMFFFHPWYGWIAIASAIVLLCLAALNEKLTGK
ALAEANKQNIAANLYTTKNLRNAEVIQSMGMLHSLIARWSVRQNKVLHLQSVASDKSGFI
TSLSKTFRMLVQSLILGVGAYLAVKQEINPGLMIAGSLLLGRALAPIDMMIGGWKGFITA
RSQYARLNEILDRQKSEQERMSLPAPEGRVQVENLVVGAPGSKTPILKNISFTVPAGSVV
GIIGPSASGKSTLARALLGVWAPQHGVVRLDGADINNWDKRELGPHIGYLPQDIELFEGS
ISENIARFGEIEPDKVIQAARMAGVHEMILQLPDGYDTVIGSEGISLSGGQRQRVGLARA
LYGNPRLLVLDEPNSNLDDVGERALASAIRQIKATDATIFIITHRTNILAQLDSLLVMHN
GTLALSGPRDKVLAELAAQQQTDLAKQARISPDAAQAGKA
NT seq 1743 nt   +upstreamnt  +downstreamnt
atgcgtaatgtacgtgagaacagcctgcaggctgccctcaagatctgcaaaggcagtttc
atttcggtcggcttcttcagttttttcgtcaatgcactgatgctggtcccttccttttat
atgctccaagtatatggacgagttctgaccagcggaagcataactacacttttgatgctc
acgcttatcatgaccgcgctcatggtgactatgggctctctggaatggacgcgctcccgg
atcatggtccgcatcagcagcaggctggatgctctgctcgggcgagatgtataccgggcg
agtttcaagcgggcactggacagtggcggaatggatgcttcggcgcaaccgctcaatgat
ctgaccggactgcggcagttcctgacgggagccggacttttcgcattcttcgatgctccc
tggttgccggtttatatcggggtcatgttctttttccatccgtggtatggctggatcgcc
attgccagcgcgatcgttctgctctgcctggccgcattgaacgagaaacttaccggcaag
gccctggcggaagccaataaacaaaatatcgcggccaatctttataccaccaagaatttg
cgcaatgccgaagtgatccagtccatgggcatgttgcatagcctcattgcccgctggagt
gtgcgccagaataaagttttgcacttgcaatcggtcgccagcgacaagagcggtttcatc
acttctctgtcgaaaacgttccgaatgctcgtccagtcgctgattcttggtgtgggcgcc
tatctggccgtcaagcaggaaatcaatcccggcctgatgatcgccggttcgcttctgctg
ggacgggcactggcgccgatcgacatgatgatcggcggttggaaggggttcatcaccgcc
cgttcgcagtatgcgcgactcaacgagattctcgaccggcagaaatccgaacaggagcgc
atgtcgttgccggcgcccgagggccgtgtccaggtggaaaacctggtcgtcggcgcgccc
ggttcgaagacgccgatcctgaagaacatcagcttcaccgtgccggccggttcggtcgtc
ggcatcatcggcccgagtgcctcgggcaagtccaccctcgccagggcactgctcggcgta
tgggcgccccagcacggcgtggtgcgcctggacggcgccgacatcaacaattgggacaaa
cgggaactcggaccccatatcggctacctgccccaggacatcgaactcttcgagggcagc
atcagcgagaacatcgcccgcttcggcgagatcgagccggacaaggtgatccaggccgcc
aggatggccggcgtgcacgagatgatcctgcaactgccggatggttacgacaccgtgatc
ggcagtgaagggatcagcctctccggcggtcagcgccagcgcgtggggctggcccgtgcc
ctctatggcaacccgcgcctgctggtcctcgacgagccgaactccaacctggacgacgtg
ggcgagcgcgccctggccagtgccatccggcaaatcaaggcgaccgatgcaaccattttc
atcattacccatcgaaccaacatcctggcccagttggactcgttgctggtgatgcacaac
ggtacgctcgcgctttccggcccgcgcgacaaggtgctggccgagctcgccgctcagcag
cagacggatctggccaagcaggccaggatctcgcccgacgccgcccaggccggcaaggct
tga

DBGET integrated database retrieval system