KEGG   Azotobacter vinelandii DJ: Avin_16260
Entry
Avin_16260        CDS       T00885                                 

Symbol
eexF
Name
(GenBank) Type I secretion outer membrane protein
  KO
K12340  outer membrane protein
Organism
avn  Azotobacter vinelandii DJ
Pathway
avn01501  beta-Lactam resistance
avn01503  Cationic antimicrobial peptide (CAMP) resistance
avn02020  Two-component system
avn03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:avn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Avin_16260 (eexF)
  09132 Signal transduction
   02020 Two-component system
    Avin_16260 (eexF)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Avin_16260 (eexF)
   01503 Cationic antimicrobial peptide (CAMP) resistance
    Avin_16260 (eexF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:avn02000]
    Avin_16260 (eexF)
   02044 Secretion system [BR:avn02044]
    Avin_16260 (eexF)
   01504 Antimicrobial resistance genes [BR:avn01504]
    Avin_16260 (eexF)
Transporters [BR:avn02000]
 Other transporters
  Pores ion channels [TC:1]
   Avin_16260 (eexF)
Secretion system [BR:avn02044]
 Type I secretion system
  alpha-Hemolysin/cyclolysin transporter
   Avin_16260 (eexF)
  RTX toxin transporter
   Avin_16260 (eexF)
  Multiple protein transporter
   Avin_16260 (eexF)
  RaxAB-RaxC type I secretion system protein
   Avin_16260 (eexF)
Antimicrobial resistance genes [BR:avn01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump AcrEF-TolC [MD:M00696]
    Avin_16260 (eexF)
   Multidrug resistance, efflux pump MdtEF-TolC [MD:M00697]
    Avin_16260 (eexF)
SSDB
Motif
Pfam: OEP
Other DBs
NCBI-ProteinID: ACO77841
UniProt: C1DS86
Position
1606901..1608319
AA seq 472 aa
MTVQRTPYIMFLALVSVSVQAAPPRSDSTPAVPSGAEKREVRASEYTADLLQLYGESRLE
DPRVLAAYARAQAGKERQREALGELLPQVSATTVFSRNTRDDDAARSSYDTERYSLTLTQ
HLYNKPAWENYQRFKSLAKRDQSEAEDAQAEAAIDLAQRYFVALASDDELELVLAERRAT
QKNLDRVNALYEKQLAMITDVLDLRARIDALAADEVDARNQVRLSREELSEVIGRPVQER
LSRIRDDIELQAPQETLEVWIDRAIAANPGLKARQDALAAADAAIREGKGGHYPSLSLNL
SALRSDAGYDNNQTNRYDNYSAGIALQVPIYSGGSTSARVRALHNDRDSAEQELEAMRRQ
VFKETTSSYLTAQASVERIRASRNALESAKKSTEAAEKGFQFGVVNAADVLTNVQNEYRA
RRDLLQAQYDFITNLLILNRWAGRLSKQTIENVNIWLAQGAPGRVARRNASR
NT seq 1419 nt   +upstreamnt  +downstreamnt
gtgaccgtgcaacgcacgccctacatcatgtttctggccctggtgagcgtctcggtacag
gccgcgcccccacggagcgattcgacgccggccgtgccgtccggcgcggaaaaacgggaa
gtccgcgcctcggaatacaccgccgatctgctgcagttgtacggggagtcgcggctggag
gacccgcgggtcctggccgcctatgcgcgcgcccaggccggcaaggagcggcaacgcgag
gcgctgggagagttgctgccgcaggtctcggcgaccaccgtgttcagccgcaacacgcgc
gacgacgatgcggcgcgtagttcctacgacacggagcgttattccctcaccttgacccag
catctctacaacaagcccgcctgggagaattaccagcgcttcaagagtctggccaaacgc
gaccagtccgaggccgaggatgcccaggcggaagcggccatcgacctggcgcagcgctat
ttcgtcgccctggcttccgacgacgagctcgagctggtcctggccgagcgccgcgccacc
cagaagaacctggaccgcgtcaatgcgctctacgaaaagcaactggcgatgatcaccgac
gtcctcgatctccgggcgcgcatcgatgcgctggccgccgacgaggtcgacgcgcgcaac
caggttcgtctcagccgcgaggagctttccgaagtcatcgggcgccctgtgcaggagcgg
ctcagccgtatccgcgacgacatcgaactgcaggctccccaggagaccctggaagtctgg
atcgatcgcgccatcgccgccaacccggggctcaaggcgcggcaggacgcgctcgcggcg
gccgatgcggccatccgcgaaggcaagggcgggcactatccctccctcagtctcaacctg
tcggcgctgcgcagcgacgccggctacgacaacaaccagacgaaccgctacgacaactat
tcggccggtatcgccctgcaggtacccatctacagcggcggttccacctccgcccgggtc
cgtgcgctgcacaacgaccgggattcggccgagcaggagctcgaggcgatgcggcgtcag
gtgttcaaggaaaccaccagctcctatctcacggcccaggccagcgtggagcggatccgc
gcctcgcgcaatgcgctcgagtcggcgaagaagtccacggaggccgccgaaaagggcttc
cagttcggcgtggtgaacgcggccgacgtgttgaccaacgtgcagaacgagtaccgggca
cggcgcgatctcctgcaagcccagtacgacttcatcaccaatcttctgattctgaatcgc
tgggccggcaggctgtccaagcagaccatcgagaacgtcaacatatggctcgcccagggc
gctccggggcgtgtcgccaggcgcaacgcatcgcgctga

DBGET integrated database retrieval system