KEGG   Azotobacter vinelandii DJ: Avin_16700Help
Entry
Avin_16700        CDS       T00885                                 

Definition
(GenBank) acetyl-CoA hydrolase/transferase family protein
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
avn  Azotobacter vinelandii DJ
Pathway
avn00020  Citrate cycle (TCA cycle)
avn00620  Pyruvate metabolism
avn00650  Butanoate metabolism
avn01100  Metabolic pathways
avn01110  Biosynthesis of secondary metabolites
avn01120  Microbial metabolism in diverse environments
avn01130  Biosynthesis of antibiotics
avn01200  Carbon metabolism
Module
avn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
avn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:avn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Avin_16700
   00620 Pyruvate metabolism
    Avin_16700
   00650 Butanoate metabolism
    Avin_16700
Enzymes [BR:avn01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     Avin_16700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans LUD_dom
Motif
Other DBs
NCBI-ProteinID: ACO77883
UniProt: C1DSC8
Position
1657680..1659176
Genome map
AA seq 498 aa AA seqDB search
MYSERIRLASLHDKIVSAAEAASLIQNGMTVGMSGFACAGDAKAVPFALVERASQEPFSI
SLVTGASIGNGLDRLMAESGLLARRMPFQADPALRKAINDGKVMFIDQHLSETVEQMRSN
QLKRPDVTVVEAVAITEDGHIVPTASVGNSANLALFADKVIVEISLRYGANLEGLHDIYL
PPERPERSPIPLVRPDQRIGATAIPVDPAKIAAIVISEYSDSPSNVLPPDAETQAIADHL
IGFFVSEVENGRLPRNLGPLQVGVGSIANAVMAGLINSPFENLSMYSEVLQDSTFELFDA
GKLDFASGSSIVLSAARGAQVFGDFERYKDRLVLRPQEISNHPEVARRLGIIGINTALEF
DIYGNVNSTHVSGTRMMNGIGGSGDFARNAQLAIFVTKSIAKDGAISSVVPMVSHVDHTE
HDVDILVTEIGLADLRGLAPRERARAIIGNCVHPQYRAALKDYFERACERGGQTPHVLEE
ALSWHINQERRGHMLAAG
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtattccgagcgtatccgcttggcttccctgcatgacaagatcgtgagtgcagccgag
gccgcttccctgatccagaatggcatgaccgtcggcatgagcggctttgcctgcgccggc
gacgccaaggccgtgcccttcgcgctggtcgagcgcgccagccaggaacccttcagcatc
agcctggtcaccggcgccagcatcggcaacggcctcgaccggctgatggccgagtccggc
ctgctggcccggcgcatgccgttccaggccgacccggcgctgcgcaaggcgatcaacgac
ggcaaggtcatgttcatcgaccagcacctgtccgagaccgtcgagcagatgcgcagcaac
cagctcaagcggcccgacgtcaccgtggtcgaggcggtggcgatcaccgaggacggccac
atagtgccgaccgcttcggtgggcaactcggccaacctggcgctgttcgccgacaaggtg
atcgtcgagatcagcctgcgctacggcgccaatctggaagggctgcacgacatctacctg
ccgccggagcgtcccgagcgctcgccgattccgctggtgcgcccggaccagcgcatcggc
gccacggccattccggtcgatccggcgaagatcgccgccatcgtcatcagcgagtacagc
gactcgccctccaacgtgctgccgccggacgcggaaacccaggccatcgccgaccacctg
atcggcttcttcgtgagcgaggtggagaacggacgcctgccgcgcaacctgggcccgttg
caggtcggcgtcggttcgatcgccaacgcggtgatggccgggctgatcaactcccccttc
gagaacctcagcatgtactcggaggtattgcaggactccactttcgagttgttcgacgcc
ggcaagctggatttcgcctcgggcagttcgatcgtcctctcggcggcccgcggcgcccag
gtgttcggcgacttcgagcgctacaaggaccgtctggtcctgcgcccgcaggagatttcc
aaccatccggaagtggcccgccgcctcggcatcatcggcatcaataccgccctggagttc
gacatctacggcaacgtcaactccactcacgtgagcggcacgcggatgatgaacggcatc
ggcggctccggcgatttcgcccgcaacgcccaactggcgatcttcgtcaccaagtccatc
gccaaggacggggccatttccagcgtggtgccgatggtcagccacgtcgatcacaccgag
cacgacgtcgacattttggtcaccgagatcggcctggccgacttgcgcggcctggcgccg
cgcgagcgggcgcgggcgatcatcggcaactgcgtgcatccgcagtaccgcgcggcgctg
aaggactacttcgaacgcgcctgcgaacgcggcgggcagaccccgcacgtgctggaggag
gcgctgtcctggcacatcaaccaggagcggcgcggccacatgctggccgccggctga

DBGET integrated database retrieval system