KEGG   Azotobacter vinelandii DJ: Avin_17360Help
Entry
Avin_17360        CDS       T00885                                 

Definition
(GenBank) Acetyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
avn  Azotobacter vinelandii DJ
Pathway
avn00071  Fatty acid degradation
avn00072  Synthesis and degradation of ketone bodies
avn00280  Valine, leucine and isoleucine degradation
avn00310  Lysine degradation
avn00362  Benzoate degradation
avn00380  Tryptophan metabolism
avn00620  Pyruvate metabolism
avn00630  Glyoxylate and dicarboxylate metabolism
avn00640  Propanoate metabolism
avn00650  Butanoate metabolism
avn00900  Terpenoid backbone biosynthesis
avn01100  Metabolic pathways
avn01110  Biosynthesis of secondary metabolites
avn01120  Microbial metabolism in diverse environments
avn01130  Biosynthesis of antibiotics
avn01200  Carbon metabolism
avn01212  Fatty acid metabolism
avn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:avn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Avin_17360
   00630 Glyoxylate and dicarboxylate metabolism
    Avin_17360
   00640 Propanoate metabolism
    Avin_17360
   00650 Butanoate metabolism
    Avin_17360
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Avin_17360
   00072 Synthesis and degradation of ketone bodies
    Avin_17360
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Avin_17360
   00310 Lysine degradation
    Avin_17360
   00380 Tryptophan metabolism
    Avin_17360
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Avin_17360
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Avin_17360
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Avin_17360
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:avn04147]
    Avin_17360
Enzymes [BR:avn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Avin_17360
Exosome [BR:avn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Avin_17360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACO77949
UniProt: C1DSJ4
Position
1721070..1722251
Genome map
AA seq 393 aa AA seqDB search
MNDAVIVSTARTALTKSWRGAFNMTHPVTLGGHVVEQAILRAGIEPGEVEDVIMGSTFLE
GPAGMNMARQIALRAGCPVTTGGLTINRFCSTGLQSIVLAAQRVIAGEGDVYVAGGVESI
SLVQNDANFALLQEAWIRQHRPAVHWDMLRTAETVAARYGIGREAQDRYGVDSQLRAAAA
QAEGRYAEEIAPLTTVMGVFERDSGHFARREITVSRDEGIRPDTTYESVAAIPSVVPGGV
IAAGNASQFSDGASACVVMNAGLAERRGLQPLGLFLGFAVAGCEPDEMGVGPVHAVPRLL
RQTGLGVDDIGLWELNEAFAVQVLYCRDRLGIDERRLNVNGGAIALGHPYGMSGSRLVGH
ALIEGRRRGVKYVVVTMCIGGGMGAAGLFEVLP
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacgccgtgatcgtttcgactgcgcgtaccgccctcaccaagtcctggcggggc
gctttcaacatgacccatcccgtgaccctcggcggacatgtcgtggaacaggccatcctg
cgcgccggcatcgagccgggcgaagtggaggatgtgatcatgggctcgaccttcctggaa
gggccggcggggatgaatatggcccgccagatcgccctgcgtgccggctgcccggtgacc
accggcggcctgaccatcaaccgcttctgttccaccgggctgcagagcatcgttctcgcc
gcgcagcgggtgatcgccggcgaaggcgacgtctacgtggccggcggcgtggagtcgatt
tccctggtgcagaacgacgccaacttcgcgctccttcaagaagcctggatccgccagcac
aggccggcggtgcactgggacatgctgcgcaccgcggaaaccgtcgccgcccgctacggc
atcggccgcgaagcgcaggaccgctacggcgtcgacagccagttgcgggccgccgccgcc
caggccgaagggcgctatgccgaggaaatcgcgccgctgaccaccgtcatgggcgtgttc
gagcgcgacagcgggcatttcgcccgccgggaaatcacggtttcccgcgacgagggcatc
cggcccgacaccacctacgagtccgtcgccgccattccgtccgtggtgccgggcggggtg
atcgccgcgggcaacgccagccagttctccgacggggcttccgcctgcgtcgtcatgaac
gcgggcctggccgaacggcgcggcctgcagcctctgggcctgttcctgggcttcgcggtc
gccggctgcgagccggacgaaatgggtgtcggcccggtccatgcggtgcccaggctgctc
aggcagaccggcctgggcgtcgacgacatcgggctctgggaactcaacgaagccttcgcg
gtgcaggtactttactgccgcgaccgcctgggcatcgacgagcggcgcctgaacgtcaat
ggcggagcgatcgccctgggacatccctacggcatgtccggctcgcgtctggtcggccac
gcgctgatcgagggacgccgccgcggcgtgaaatacgtggtggtgaccatgtgcatcggc
ggtggcatgggcgccgcgggactcttcgaggtgctgccatga

DBGET integrated database retrieval system