KEGG   Azotobacter vinelandii DJ: Avin_18540
Entry
Avin_18540        CDS       T00885                                 

Definition
(GenBank) outer membrane efflux protein
Organism
avn  Azotobacter vinelandii DJ
SSDB
Motif
Pfam: OEP
Other DBs
NCBI-ProteinID: ACO78066
UniProt: C1DDU5
Position
1833651..1834931
AA seq 426 aa
MFPSKTKKWLPCALLVLAGGASWAQAAEPRSATAGAFSLKQAFDAAWARQPEAQSLSTRN
EAARARREVADGWLAEPAALSLSTEGDQLDGNDGSREHIVGLSLPLWLPGERSRMGAVAD
AEAQATTSGALAAQLRTAAQVREVYWQWQRARVERDLARERQAKARQLAADVARRVVAGE
LALADRHQAEGAAALADMELTTAESVLAGAAQRLRTLTGMRPVEAASPPERIVDGEPEPA
DSEDAPALEAAHPALAALRAQSEVARSSAELARVQTRANPELTLSATRERERSGESYDQT
LLVGVRIPFGSASRNRAKQASAQADAIEAEVQWRLERERVLADLEAARLRLDAAVAKARA
AEQRARLAEESRGFFDKSFRLGETDLPTRLRIELEASEARRQAALAGLDRTAATSDLRQA
LGLLPE
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgttcccaagcaaaaccaagaaatggttgccctgcgccctgctggtgctggccggcggc
gcttcctgggcgcaggccgcggagccgcgatccgccacagccggtgccttttcgctgaag
caggcgttcgatgccgcctgggctcgccagcccgaagcgcagtcgctgtccacccgtaac
gaggcagccagggcgcggcgcgaggtcgccgatggctggctcgccgagccggcggccctg
tcgttgtcgaccgagggcgatcaactcgacggtaacgacggtagccgcgagcacatcgtc
ggcctgtcgctgccgttgtggctgcccggcgagcgctcgcggatgggggccgtggccgac
gccgaggcgcaggccacgacgagcggcgcgctggcggcgcagttgcgcacggcagcgcag
gtccgcgaagtctattggcaatggcaacgggctcgcgtggagcgggatctggcccgcgag
cggcaggccaaggcgcggcaactggccgcggatgtcgcccggcgggtcgtggccggagaa
ctggcgctggccgaccgtcaccaggccgagggcgccgccgccctggccgacatggagctg
accacggccgagtccgtgctggccggtgccgcgcagcggttgcggacgctgaccggcatg
cgtcccgtggaggccgcgtcgccgccggagcggatcgtcgacggcgaaccggagcccgcc
gacagcgaggatgcgcctgcgctggaggccgcccatcccgcgctggcggcattgcgcgcg
cagagcgaggtggcacgcagttcggccgaactggcgcgggtgcagacccgcgccaatccc
gagttgaccctgtcggcgacgcgcgagcgggagcgttcgggcgaatcctacgaccagacc
ctgctggtgggcgtgcgcattccgttcggctcggcgagccgcaaccgggccaagcaggcc
agcgcccaggccgacgccatcgaggccgaggtgcagtggcgcctggagcgtgagcgcgtg
ctggccgacctggaggccgcccgtctgcgcctcgacgccgccgtggcgaaggcccgcgcc
gccgagcagcgcgcccggctcgccgaggagtcgcgcggcttcttcgacaaatccttccgc
cttggcgaaaccgacctgccgacccgcctgcgcatcgagctggaggcgagcgaggcgcgc
cgccaggccgccctggccgggctcgaccggacggccgccacctccgacttgcgccaggcc
ctcggcctgctgcccgaatga

DBGET integrated database retrieval system