KEGG   Azotobacter vinelandii DJ: Avin_20050Help
Entry
Avin_20050        CDS       T00885                                 

Definition
(GenBank) methyltransferase-like protein
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
avn  Azotobacter vinelandii DJ
Brite
KEGG Orthology (KO) [BR:avn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:avn03009]
    Avin_20050
Enzymes [BR:avn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     Avin_20050
Ribosome biogenesis [BR:avn03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Avin_20050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ
Motif
Other DBs
NCBI-ProteinID: ACO78212
UniProt: C1DEM7
Position
1993952..1995013
Genome map
AA seq 353 aa AA seqDB search
MNSLLLHCRPGFEGEVCAEIGEHAGRLNVAGYARAKPNSAHAEFVCSEPGGAERLMRELR
FAGLVFPRQWARGAFVELPESERIGVLLEHLAAYPVCGSLWLEVLDSNEGKELSTFCRKF
EVPLRKALGKTGRLLDDPRRPRLLLTFRSGREVFLGLAEPDNSAAWPMGIPRLKFPREAP
SRSTLKLEEAWHQFIPREAWDLRLAPGMSAVDLGAAPGGWTWQLVNRHMKVTAVDNGPMA
QSLMDSGLVEHVRADGFVFRPRRPVDWMVCDIVEKPARTAALIETWLGEGLCREAVVNLK
LPMKQRHAEVRRLLERIRDGLSARGAKVSVACRQLYHDREEVTCHLCRLPAPA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcctgttgttgcattgccgtcccggtttcgaaggcgaagtctgcgccgagatc
ggcgagcacgccggacgcctgaacgtggccggctatgccagggccaagccgaacagcgcc
catgccgaattcgtctgcagcgagccgggcggcgccgagcgactgatgcgcgagctgcgc
ttcgccgggctggtctttccccgccagtgggcacgtggcgctttcgtcgagctgcccgag
agcgagcgcattggcgtcctgctcgagcacctggccgcttacccggtctgcggcagcctc
tggctggaggtgctggacagcaacgagggcaaggagctgtcgaccttctgccgcaagttc
gaggtgccgctgcgcaaggcgctgggcaagaccggcagattgctggacgatccgcgccgg
ccgcgcctgctgctgaccttcaggagtggccgcgaggttttcctcggcctggccgaaccg
gacaactcggcagcctggccgatgggcatcccgcgcctgaagtttccccgcgaggcgccg
agccgttcgaccctcaagctggaggaggcctggcaccagttcattccacgcgaggcctgg
gatctgcgtctcgcgccggggatgagcgccgtggacctcggcgccgcgcccggtggctgg
acctggcaactggtcaaccgccatatgaaggtgaccgccgtggataacgggccgatggcg
cagagcctgatggattccggactggtcgagcacgttcgcgccgatggtttcgttttccgc
ccgcgccggccggtcgactggatggtctgcgacatcgtcgagaagcccgcccgcacggcc
gccctgatcgagacctggctcggcgaggggctctgccgcgaggcggtggtcaacctcaag
ctgccgatgaagcagcgccatgccgaggtgcgccgcctgctcgagcgcatccgcgatggt
ctgagcgcacggggcgccaaggtgtccgtcgcctgccgccagctctaccacgatcgcgag
gaagtgacctgtcatctgtgtcggctaccggccccggcgtga

DBGET integrated database retrieval system