KEGG   Azotobacter vinelandii DJ: Avin_20290Help
Entry
Avin_20290        CDS       T00885                                 

Definition
(GenBank) xylitol dehydrogeanse
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
avn  Azotobacter vinelandii DJ
Pathway
avn00040  Pentose and glucuronate interconversions
avn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Avin_20290
Enzymes [BR:avn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     Avin_20290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 HI0933_like AlaDh_PNT_C Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ACO78233
UniProt: C1DEP8
Position
complement(2019440..2020483)
Genome map
AA seq 347 aa AA seqDB search
MKALVLEKQHDLKIRDIDLPTPPVGPDDVRIRIHTVGVCGSDVHYYTHGRIGHFIVDRPL
VLGHEAAGTVVEVGSGVTRLAVGDRVCMEPGIPDPKSKASRLGLYNVDPSVVFWATPPVH
GCLTPEVVHPAAFVYKLPDNVGFAEGALVEPFAIGMQAAVKARIKPGDVAVVIGAGTIGM
MTALAALAGGASRVLVSDLMVEKLAIAQRYEGITAVNVRERSLRDAVAEVTDGWGADVVF
EASGSARAYGDALAAVCPGGALVLVGMPVEPVPFDVVAAQAKEIRIETVFRYANVYERAV
NLIASGKVDLKPLVSATYPFERGVEAFERAASARPGDVKVQITFGDG
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctctggtcctggaaaagcagcacgacctgaagatccgcgacatcgacctgccc
acgccgccagtggggccggacgacgtgcgcatccgcatccataccgtcggcgtgtgcggc
agcgacgtgcactactacacccacgggcgcatcggtcatttcatcgtcgaccggccgctg
gtgctgggacacgaggcggccggcacggtcgtcgaggtcggcagcggcgtcacccgcctg
gccgtgggcgaccgcgtctgcatggagcccggcattcccgatcccaagtcgaaggcctcg
cgcctgggcctctacaacgtcgatccttcggtcgtgttctgggccaccccgccggtgcac
ggctgcctgaccccggaagtcgtccatccggcggctttcgtctataaactccccgacaac
gtcggcttcgccgagggggcgctggtggagcccttcgcgatcggcatgcaggcggccgtc
aaggcccgcatcaagcccggcgacgtcgccgtggtcatcggcgccggcaccatcggcatg
atgaccgccctggccgcgctggccggcggcgcgagccgggtgctggtgtccgacctgatg
gtggagaagctggccatcgcccagcgctatgaaggcatcaccgccgtcaacgtgcgcgag
cgctccctgcgcgacgcggtggccgaggtcaccgacggctggggcgcggatgtggtgttc
gaggccagcggtagcgcccgggcctatggcgatgcactggcggcggtctgcccgggcggg
gcgctggtattggtgggcatgccggtcgagccggtgcccttcgacgtggtggcggcccag
gccaaggagatccgcatcgagaccgtgttccgctacgccaatgtctacgagcgggcggtg
aacctgatcgccagcggcaaggtcgatctgaagccgctggtctcggcgacctaccccttc
gaacggggtgtcgaggccttcgagcgggccgccagcgcccggccgggcgatgtgaaggtg
cagatcaccttcggcgacggctga

DBGET integrated database retrieval system