KEGG   Azotobacter vinelandii DJ: Avin_23410Help
Entry
Avin_23410        CDS       T00885                                 

Gene name
pfkB
Definition
(GenBank) 6-phosphofructokinase II
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
avn  Azotobacter vinelandii DJ
Pathway
avn00010  Glycolysis / Gluconeogenesis
avn00030  Pentose phosphate pathway
avn00051  Fructose and mannose metabolism
avn00052  Galactose metabolism
avn00680  Methane metabolism
avn01100  Metabolic pathways
avn01110  Biosynthesis of secondary metabolites
avn01120  Microbial metabolism in diverse environments
avn01130  Biosynthesis of antibiotics
avn01200  Carbon metabolism
avn01230  Biosynthesis of amino acids
Module
avn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Avin_23410 (pfkB)
   00030 Pentose phosphate pathway
    Avin_23410 (pfkB)
   00051 Fructose and mannose metabolism
    Avin_23410 (pfkB)
   00052 Galactose metabolism
    Avin_23410 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    Avin_23410 (pfkB)
Enzymes [BR:avn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Avin_23410 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: ACO78529
UniProt: C1DHD4
Position
2342007..2342945
Genome map
AA seq 312 aa AA seqDB search
MEFAMSCIVTLTLNPAMDVSTAVARLEPTRKLRCGPPRYEPGGGGINVARVIRALGGESV
AVYPAGGPFGEMLQHALEALGLPQVRVPIAGDTRESFTVDEGETGLQYRFVLPGPTLTPT
ERRNCLETIAALVPAPSHLVVSGSFPSGVALDFHDEILDLARRLGARLVLDYSGEALRHA
VARGGIYLLKPSLSELSSLAGRRLDDEAGQEEEARRLVERGAVEIVVLSLGAGGALLASR
EGIERFSAFDVPLRSAVGAGDSVVGATVLALSRGWSLHDAVRYGMAAAAATLMRPGTGLC
RAEDVERLYREG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
ctggagttcgccatgtcgtgtatcgtcaccttgaccctgaacccggcgatggatgtctcg
accgccgttgcgcggctcgagccgacccgcaagctgcgttgtggtccgccgcgctacgag
ccgggcggtggcgggatcaacgtggcgcgagtgatccgggcactcggcggcgagagcgtg
gcggtctatccggccggcggtccgttcggcgagatgctgcagcatgcgctggaggcgctc
ggtctgccccaggtgcgggtgccgatcgctggcgatacccgggaaagtttcaccgtggac
gagggtgaaaccggcctgcagtaccgtttcgtcctgcccggcccgaccttgactccgacg
gagcggcggaactgtctggaaaccatcgccgcgcttgtgccggcgccatcccatctggtc
gtcagtggcagttttccgtccggcgtggcgctggatttccacgacgaaatcctggatctg
gcgcggcgcctgggggcgaggctggtgctcgactactcgggagaggccctgcgccatgcg
gtggcccgcggaggtatctacctgctcaagccgagcctgagcgagctctccagcctggcg
gggcggcgactggacgacgaggccggacaggaggaggaggcacgccggctggtcgagcgg
ggcgcggtggagatcgtcgtcctgtccctcggcgccggcggcgcgctgctggcgagccgg
gaaggcatcgagcgcttttccgccttcgacgtgcccttgcgcagtgcggtgggggccggc
gacagcgtggtcggcgccacggtactcgccttgagtcgcggctggagcctgcacgatgcg
gtgcgctacggcatggccgcggcggccgcgaccctgatgcgccccggcaccgggctgtgc
cgggcggaagatgtcgagcgcctgtatcgcgagggctaa

DBGET integrated database retrieval system