KEGG   Azotobacter vinelandii DJ: Avin_26630Help
Entry
Avin_26630        CDS       T00885                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
avn  Azotobacter vinelandii DJ
Brite
KEGG Orthology (KO) [BR:avn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:avn02044]
    Avin_26630
Secretion system [BR:avn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Avin_26630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssF TraC
Motif
Other DBs
NCBI-ProteinID: ACO78839
UniProt: C1DJS0
Position
complement(2728190..2730052)
Genome map
AA seq 620 aa AA seqDB search
MDARLLDYYNRELGYLRELGAEFAERFPKVAGRLGMHGIEIADPYVERLLEGFSFLTARI
QLKMDAEFPRLSQHLLDVIHPNYSAPMPAMAIVRLQPSLNEGSLANGFTLPAGTALHANL
AHGEQTVCEFRTGHALTLWPLELDGVHYGRVPTDLPAGAYRQRARAALRIRLRITAGQRC
DSLALERLEFHLAGPEQRALRLLELIAGHSVAVLCREAGPDGAWGTPLDAACVRHEGFSA
SQALLPDDGRTFQGYRLLQEYFACPARFLFFSVGGLRRALQGLRGERFELLLLFDQDDAA
LERLVETDDLALHCTPVVNLFAKRADRVLVSPRSRDYHLVVDRTRALDYEVHSVTRMSGH
GSGSEAQEFRPFYASFGADGRDHGAYYALRREPRLLSEQARLHGSRTGYVGSEIFVSLVD
QHEAPFGAALRHLVVETLCTNRDLPLLLPLDGDSDFSLAVSAPVGRVKVLRGPTRPRPSL
AEGAQTWKLISHLGLNHRLMTELDGERGAAMLRQLLALYLDDAESGLRRQVESLRRVACS
PVFRRLPQPGPLMHGRGVQVAVTLDEQAFSGDSPFLFGAVLEQFFARHVAINLFSELTLH
SLQRGQVARWAPRLGARPVA
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgcgtctactggattactacaaccgggaactgggctacctgcgcgagctggga
gcggagttcgccgaacgttttcccaaggtggccggccgcctgggcatgcacggcatcgaa
atcgccgacccctatgtcgagcgcctgctcgaaggtttcagcttcctcaccgcgcgcatc
caactgaagatggacgcggagtttccgcgcctttcccagcacctgctcgatgtgatccat
cccaactactcggcgccgatgccggcgatggccatcgtcaggctgcaacccagcctcaac
gagggcagcctggccaacggcttcacgctgcccgccggcaccgcgctgcatgccaacctg
gcccacggcgagcagaccgtctgcgagttccgcaccggccatgcgctcaccctgtggccg
ctggagctggacggcgtgcactacggccgggtgcccaccgacctgcccgccggggcatac
cggcagcgcgcccgcgccgccctgcgcatccgcctgcgcatcaccgccggccagcgctgc
gacagcctggccctggagcggctggagttccacctggcgggccccgagcagcgggcgctg
cgcctgctggagctgatcgccggtcacagcgtcgcggtgctctgccgcgaggccggcccg
gacggcgcctggggcacgccgctggacgccgcctgcgtgcgtcacgagggcttttccgcc
agccaggcgctgttgcccgacgacggccgcaccttccagggctaccggctgctgcaggaa
tacttcgcctgcccggcgcgtttcctgttcttcagcgtcggcggcctgcgccgcgcgctg
caggggctgcggggcgagcgcttcgaactgctgctgctgttcgatcaggacgacgccgca
ctggagcgcctggtggagacggacgacctggcgctgcactgcacgccggtcgtcaacctg
ttcgccaagcgcgccgaccgggtgctggtctcgccgcgcagccgcgactaccacctggtg
gtggaccgcacccgggcgctcgactacgaggtgcattcggtcacccgcatgtccggccac
ggcagcggcagcgaggcccaggagttccgtccgttctacgcctcgttcggcgccgacgga
cgcgaccacggcgcctactacgcgctgcgccgcgagccgcgcctgctctccgagcaggcc
cgcctgcacggcagccgcaccggctatgtcggcagcgaaatcttcgtttccctggtggat
cagcacgaggcgcccttcggcgcggcgctccgccatctggtggtggagacactgtgcacc
aaccgcgacctgccgctgctgctgccgctggacggcgacagcgatttctcgctggcggta
tcggccccggtgggacgggtcaaggtgttgcgcgggccgacccggccccggccgtcgctg
gccgagggcgcgcagacctggaagctgatcagccacctgggcctgaaccatcggctcatg
accgaactggacggcgagcgcggcgcggccatgctgcgccagttgctggccttgtacctg
gacgacgccgagtcgggcctgcggcgccaggtggaaagcctgcggcgggtcgcctgcagc
ccggtgttccgccgcctgccgcaacccggccccctgatgcacgggcgcggcgtgcaggtg
gcggtgacgctggacgaacaggcgttctccggcgacagcccctttctgttcggcgccgtg
ctggagcagttcttcgcccgccacgtggcgatcaacctgttctccgaactgacgctgcac
agcctgcagcgcggccaggtggcgcgctgggcgccccggctgggcgcgaggccggtggca
tga

DBGET integrated database retrieval system