KEGG   Azotobacter vinelandii DJ: Avin_26650Help
Entry
Avin_26650        CDS       T00885                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06887  uncharacterized protein
Organism
avn  Azotobacter vinelandii DJ
Brite
KEGG Orthology (KO) [BR:avn00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Avin_26650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP Calycin_like
Motif
Other DBs
NCBI-ProteinID: ACO78841
UniProt: C1DJS2
Position
complement(2730697..2731179)
Genome map
AA seq 160 aa AA seqDB search
MHLKIEGVQGESQESQHAAWLDIKSFTWGISQPGSLDSGGGGTPGRASFTDLHVVSYVEA
SAPTAFKKCANGTSLGTVELSCSRLSDGDKMVFMTITLTNVLVTKADIKGVDRDDEQERL
LIEYAFQAPEVEFGYTPQQDDGSAGGEVTMGWNIPQNTEL
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgcacctgaagatcgagggcgtccagggcgagtcccaggagtcccaacacgctgcctgg
ctcgacatcaagtcgttcacctggggaatcagccagcccggctccctggattccggcggc
ggcggcacccccggccgggccagcttcaccgacctgcacgtggtttcctacgtggaggcc
tccgcgccgaccgcgttcaagaagtgcgccaacggcaccagcctgggaacggtggaactg
tcctgctcccggctctccgacggcgacaagatggtcttcatgaccatcaccctgaccaac
gtgctggtcaccaaggcggacatcaagggcgtcgacagggacgacgagcaggagcgcctg
ctcatcgagtacgccttccaggcccccgaggtggaattcggctacacgccccagcaggac
gacggcagcgcgggcggcgaggtcaccatgggctggaacatcccccagaacaccgagctc
tga

DBGET integrated database retrieval system