KEGG   Azotobacter vinelandii DJ: Avin_29800Help
Entry
Avin_29800        CDS       T00885                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase cytochrome b556 small membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
avn  Azotobacter vinelandii DJ
Pathway
avn00020  Citrate cycle (TCA cycle)
avn00190  Oxidative phosphorylation
avn00650  Butanoate metabolism
avn01100  Metabolic pathways
avn01110  Biosynthesis of secondary metabolites
avn01120  Microbial metabolism in diverse environments
avn01130  Biosynthesis of antibiotics
avn01200  Carbon metabolism
Module
avn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
avn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
avn_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Avin_29800 (sdhD)
   00650 Butanoate metabolism
    Avin_29800 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    Avin_29800 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: ACO79146
UniProt: C1DM59
Position
complement(3083831..3084199)
Genome map
AA seq 122 aa AA seqDB search
MVTNVTNFSRSGLYDWMAQRVSAVILAAYTLFLLGYLFFSSDLSYAEWHGLFSSTGMRIF
SLLALVALSVHAWVGMWTISTDYLTPMALGKLATVVRFLFQAACGIAMFAFFVWGVQILW
GI
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaatgtcacgaatttctcgcgctcgggcctctacgactggatggcccagcgt
gtctccgcggtcattctcgcggcatacaccctcttcctgctgggttacctgttcttcagc
tcggatctgagctacgccgaatggcatggtctgttctccagcaccggtatgcggatcttc
agtctgctggctctcgtcgccctgagcgtacacgcctgggtcggcatgtggaccatctcg
accgactacctgactccgatggcgctgggcaagctggcgaccgtcgtgcgtttccttttc
caggccgcgtgtggcatcgccatgttcgcgtttttcgtctggggtgtgcagattctttgg
ggtatctga

DBGET integrated database retrieval system