KEGG   Azotobacter vinelandii DJ: Avin_30580Help
Entry
Avin_30580        CDS       T00885                                 

Gene name
lapF
Definition
(GenBank) Acetaldehyde dehydrogenase (acetylating); LapF
  KO
K18366  acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
avn  Azotobacter vinelandii DJ
Pathway
avn00362  Benzoate degradation
avn00620  Pyruvate metabolism
avn00621  Dioxin degradation
avn00622  Xylene degradation
avn00650  Butanoate metabolism
avn01100  Metabolic pathways
avn01120  Microbial metabolism in diverse environments
avn01220  Degradation of aromatic compounds
Module
avn_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Avin_30580 (lapF)
   00650 Butanoate metabolism
    Avin_30580 (lapF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Avin_30580 (lapF)
   00622 Xylene degradation
    Avin_30580 (lapF)
   00621 Dioxin degradation
    Avin_30580 (lapF)
Enzymes [BR:avn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Avin_30580 (lapF)
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     Avin_30580 (lapF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ACO79223
UniProt: C1DN56
Position
complement(3166927..3167841)
Genome map
AA seq 304 aa AA seqDB search
MKKIRCALIGSGNIGTDLIYKIRRSALLEPVWMVGIDPASEGLARARELGLKTTAEGVDG
LLPHVQEDDIQIAFDATSAYVHAENSRKLNALGVLVIDLTPAAIGPLCVPPVNLREHAAR
LEMNVNMISCAGQATIPVVHAVSRIQSVAYAEIVASLASKSIGPGTRANLDEFTYTTSGA
LEKVGGARRGKALAIINPAEPPMIMRNTISCLTDAEPDQERLSASILQMVGEVQKYVPGY
RLVNGPLYDGNGVSVFMEVAGLGDYLPTYAGNLDIMTAAATRTAEMFAEEILAGKIRLPT
PEVA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagatccgttgcgccttgatcggctcgggcaacatcggcaccgacctgatctac
aagatccgccgcagcgcgctgctggagccggtgtggatggtcggcatcgaccccgcctcc
gaggggctggcgcgcgcccgcgagctgggtctgaagaccaccgccgagggtgtcgacggc
ctgctcccgcatgtgcaggaggacgacatccagatcgccttcgacgccaccagcgcctac
gtgcacgccgagaacagccgcaagctcaacgccctgggcgtgctggtgatcgacctgacc
ccggcagccatcggcccgttgtgcgtgccgccggtgaacctgcgcgagcacgccgccaga
ctggaaatgaacgtcaatatgatttcctgcgccgggcaggcgaccattccggtcgtccac
gcggtgtcgcgcatccagagcgtggcctatgccgagatcgtcgccagcctggcgtcgaaa
tccatcgggccgggcacccgcgccaacctcgacgagttcacctacaccacctccggcgcg
ctggagaaggttggcggcgcgcgccggggcaaggcgctggcgatcatcaatccggccgag
ccgccgatgatcatgcgcaacaccatctcctgcctgaccgacgcggaaccggaccaggaa
cgcctcagcgcctcgatcctgcagatggtcggcgaggtgcagaagtacgtgccgggctac
cggctggtcaacgggccgctctacgacggcaacggggtgtcggtgttcatggaagtggcc
ggcctcggcgactacctgccgacctacgccggcaacctcgacatcatgaccgcggcggcg
acccgcaccgccgagatgttcgccgaggaaatcctcgccggaaaaatccgcctgcccacc
ccggaggtcgcatga

DBGET integrated database retrieval system