KEGG   Azotobacter vinelandii DJ: Avin_35660
Entry
Avin_35660        CDS       T00885                                 

Gene name
trbL
Definition
(GenBank) P-type conjugative transfer protein TrbL
  KO
K07344  type IV secretion system protein TrbL
Organism
avn  Azotobacter vinelandii DJ
Pathway
avn02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:avn00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Avin_35660 (trbL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:avn02044]
    Avin_35660 (trbL)
Secretion system [BR:avn02044]
 Type IV secretion system
  Trb secretion system protein
   Avin_35660 (trbL)
SSDB
Motif
Pfam: TrbL
Other DBs
NCBI-ProteinID: ACO79713
UniProt: C1DR55
Position
complement(3637811..3639184)
AA seq 457 aa
MNDVTIIDRFLDTFSRYIDSGFGLLQGEVAFLTATLIVIDMTIAGLYWAMSHATGQGEDV
IAKLLRKVLYVGAFAYIIGNFNWLAGIVFRSFAGLGLTATGSAITMENFLQPGRLAKTGI
DAGAPILEQIGDMAGFPEVFTNIDPIVVMFLAWLVVTLCFFVLAVQLFITLIEFKLTTLA
GFVLVPFALWNKTSFLAEKVLGNVVSSGVKVLVLAVIVGIGSGLFAEFQTVPDEPSIDHA
LVVMLASLSLLALGIFGPGIATGLVSGAPQLGAGAMAGAAVGAVGTGVAIGAAATGVGGA
VMAGARMAPAAAKLAGSGARAATSAASSAKSAFQAGSAAAGDGAKGATAGLGNVAKTGVQ
AAGRRAASGASAAGQKMAGSFRAGWNGADAGAAGSGQAAAGEGANSAASAPKQEQPAWAK
RMHRRQQITHAATTTAHTLRGGDGGGSGQGPSLRSDE
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgaacgacgtgaccatcatcgatcgcttcctcgacacgttctcgcgctacatcgactcg
ggcttcggtctgttgcagggcgaagtggcgttcctgaccgccacgctcatcgtcatcgac
atgacgatcgccggcctgtactgggccatgagccacgcgaccggccagggcgaagacgtg
atcgccaagctgctgcgcaaggtgctctacgtcggcgccttcgcctacatcatcggcaac
ttcaactggctggccggcatcgtattccgctcgttcgccggcctgggcctgacggccacc
ggctcggccatcacgatggagaacttcctgcaaccgggacggctggcgaaaaccggcatc
gacgcgggtgcgccgattctggagcagatcggcgacatggccgggttccccgaagtgttc
acgaacatcgacccgatcgtggtgatgttcctcgcgtggctggtcgtcaccctctgcttc
ttcgtgctggcggtgcagcttttcatcacgctgatcgagttcaagctgaccacgctcgcc
ggcttcgtgctggtgccgttcgcgctctggaacaagacgagcttcctggcggaaaaggtg
ctcggcaacgtggtgtcgtctggcgtcaaggtactggtgctggccgtcatcgtcggcatc
ggttcgggcctgttcgccgagttccagaccgtgccggatgaaccgtccatcgaccatgcc
ctggtcgtgatgctggcttcgctctcgctgctggccttgggcatcttcgggccgggtatc
gccacgggcctcgtgtcgggtgcaccgcagcttggcgcgggcgcgatggccggcgccgct
gtcggcgctgtcggcacgggcgttgccattggcgccgccgcaactggcgtgggcggtgcg
gtcatggccggggcgcgcatggcgccggcggccgccaagctggccggcagcggcgcacgc
gccgccacgtcggcggccagcagcgccaagtcggcattccaggccggttccgccgctgcg
ggcgacggggccaagggggcgactgccggcctcggcaatgtcgccaagaccggcgtacag
gcggcaggccgccgtgccgcgtccggagcttccgctgccgggcagaagatggccggttcc
ttccgtgccggctggaacggcgcggatgccggcgccgccggctccggccaggccgccgca
ggcgaaggtgcaaacagcgccgccagcgcaccgaagcaggaacaacccgcctgggccaag
cggatgcaccgccgccagcaaatcacccatgccgcgactactaccgcccacacgctgcgc
ggtggcgacggcggcggctcggggcaaggcccgagcctgcgctccgatgaatga

DBGET integrated database retrieval system