KEGG   Azotobacter vinelandii DJ: Avin_35690
Entry
Avin_35690        CDS       T00885                                 
Symbol
trbE
Name
(GenBank) P-type conjugative transfer protein TrbE
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
avn  Azotobacter vinelandii DJ
Pathway
avn02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:avn00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Avin_35690 (trbE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:avn02044]
    Avin_35690 (trbE)
Enzymes [BR:avn01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Avin_35690 (trbE)
Secretion system [BR:avn02044]
 Type IV secretion system
  Trb secretion system protein
   Avin_35690 (trbE)
SSDB
Motif
Pfam: P-loop_TraG CagE_TrbE_VirB HerA_C AAA_10 TraG-D_C AAA_22 CbiA DUF87 Zot AAA_16 ABC_tran
Other DBs
NCBI-ProteinID: ACO79716
UniProt: C1DR58
Position
complement(3640230..3642680)
AA seq 816 aa
MLNLAEYRQRPALLADWLPWAGLVAPGVVLNKDGSFQRTARFRGPDLDSATQGELIATSA
RLNNALRRLGSGWALFIEAERRPAADYPHSDFPEPLSWLVDEERRAAFEESGHHFESAYH
LTLAYLPPEESRARAAKLLYENSPGDGVDWRGRLDTFVAETDRVFDLLDGVMPEIAWLDD
AGTLTGLHATVSTRRCRLGVPEVPFHIDALLADCALVGGLAPMLGDQHLRVVSVRGFPTS
TWPGILDDLNRLGFGYRWSTRFLCMDKAEAEKELGRLRRQWFAKRKNVVALLRETIFQQE
SPLVDTDASNKAADADAALQELGGDQVAFGYLTATVTVLDADPAAADEKLRMVERVIQGR
GFVTIPETLNAVDAWLSSIPGNAYANVRQPIVSTLNLAHMMPLSAVWAGPEKNDHLDGPP
LIVTRTDGATPFRLVTHIGDVGHTLVAGPTGMGKSVLLAILAMQFRRYPGSRIFAFDMGR
SMRATVLGLGGEHYDLGADGGIAFQPLARIEQEGYRTWAAEWVEGRLLHEGVTVGPDEKA
TIWSALGSLAGAPVEQRTLTGLSVLLQSNALRQALSPYVLGGAHGKLLDADRDRLGSGDV
QGFEMEELMHSPAAVQAVLRYLFARFDERFDGAPTLLILDEAWLFLDEPSFAARIRQWLK
TLRKKNVSVIFATQSLADIKDSTIAPAIIESCASRIFLPNPQATEPQIRTIYEGFGLNSR
QIEIVATAQPKQDYYYQSRLGNRLFDLDLGPAALAFAGASTPQDQRDIDRVLTQAGAPGF
AGAWLRHRGLDWAADLLPASPAAASFLASQPLEVSP
NT seq 2451 nt   +upstreamnt  +downstreamnt
atgctgaaccttgccgaataccgccagcggcccgcgctgctggccgactggctgccctgg
gccgggctggtcgcgccgggtgtcgtcttgaacaaggatggcagtttccagcgcacggcg
cgctttcgcgggcctgatctggacagcgccacgcaaggcgagctgatcgccacgtcggcg
cggctcaacaacgcgctgcgccgcctgggttcgggctgggcattgttcatcgaggccgag
cgccggccggcggcggactatccgcactccgactttcctgaaccgctttcctggctggtc
gatgaagaacgccgcgcggccttcgaggaatcggggcatcacttcgagagcgcctatcac
ctgacgctcgcgtacctgccgccggaggaatcgcgcgcccgcgcggccaagctgctctac
gagaactcccccggcgacggcgtggactggcgtggccggctcgataccttcgtggcggaa
accgatcgcgtgttcgacctgctcgacggcgtgatgccggaaatcgcctggctcgatgat
gccggcacgctaaccggcctgcacgcgacggtttcgacgcggcgctgccggctgggcgtt
cccgaagttccgttccatatcgacgcgctgctggccgactgcgccctggtcggtggcctt
gcgccgatgctgggcgaccaacacctgcgcgtggtgtcggtgcgaggctttccgacttcg
acgtggcccgggattctggacgacctcaaccgcctgggctttggctaccgctggagcacg
cgctttctctgcatggacaaggcggaagcagaaaaagaacttggccgcctgcgccgccag
tggtttgcgaaacggaagaacgtcgtcgcgctgctacgcgaaacgatcttccagcaggaa
agcccgctggtcgataccgacgccagcaacaaggcggccgacgccgatgccgccttgcag
gagctgggcggcgatcaggtggccttcggctacctcaccgccacggtgacggtgctcgat
gccgacccggccgcggcggacgagaagctgcgcatggtggagcgcgtcatccagggccgg
ggtttcgtgaccattccggaaaccctcaatgccgtcgatgcgtggctgtcgtccattccc
ggcaatgcctatgcgaacgtgcgccagcccatcgtttcgacgctgaatctggcgcacatg
atgccgctgtcggcggtatgggctgggccggagaagaacgaccacctcgacggcccgccg
ctgatcgtcacccgcaccgatggcgcgacgccttttcgcttggtcactcacatcggcgac
gtaggccacacactagtcgccgggccgaccggcatgggcaagtcggtactgcttgccatc
ctggcgatgcagttccggcgctatcccggctcgcgcatcttcgctttcgacatgggccgc
tccatgcgggcgactgtgttgggcttgggcggcgagcactacgacctcggcgccgatggt
ggcatcgcgttccagcccttggcccgtatcgagcaggaaggctatcgcacctgggcggcc
gaatgggtggaaggccgcctgctgcatgaaggcgtgaccgtcggcccggacgagaaggcg
accatctggtcggcgctgggcagcctcgcgggtgccccggtggaacagcgcacgctgacc
gggctttcagtgctgctgcaatcgaacgcgctgcgccaggcgctgtcgccgtatgtgctc
ggcggcgcgcacgggaagctgctggacgccgaccgcgaccggctcggcagcggcgacgtg
cagggcttcgagatggaagaactgatgcacagccctgccgccgtgcaagcggtgctgcgc
tatctgttcgcccgcttcgacgagcgtttcgacggtgcgcccacgctgctgatcctcgat
gaagcctggctgtttctcgatgagccgtcctttgccgcccgcatccggcaatggctcaag
acactgcgcaagaagaacgtgtcggtcatcttcgccacacagagtctggcggacattaag
gattcgaccatcgcgccggccatcatcgaaagctgcgccagccggattttcttgcctaac
ccgcaggccaccgagccgcagattcgcacgatctacgagggcttcggcctcaacagccgg
caaatcgaaatcgtcgccaccgcgcagcccaagcaggactactactaccaatcgcgcctg
ggaaaccgcctgttcgacctcgacctggggccggccgcgctcgccttcgcgggcgcatcc
acaccgcaagaccaacgcgacatcgaccgcgtgctgacgcaggccggcgcccccggcttc
gccggcgcgtggctgcgccatcgcggcctcgattgggccgccgatctgctgccggcctcg
ccggcggcggcttctttcctcgcttctcaaccgctggaggtttcgccatga

DBGET integrated database retrieval system