KEGG   Azotobacter vinelandii DJ: Avin_36220Help
Entry
Avin_36220        CDS       T00885                                 

Definition
(GenBank) conserved hypothetical protein
Organism
avn  Azotobacter vinelandii DJ
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2976
Motif
Other DBs
NCBI-ProteinID: ACO79769
UniProt: C1DRB1
Position
3687489..3687833
Genome map
AA seq 114 aa AA seqDB search
MPKKTKTLRHIAIAVALAVPQLTFAALPQAQAPSRGEGTNIIQTLQNYGYDGAMLLALLL
LAAMFLGVAAHAYGVYHEIHEGKKKWRDLGATAAVGVCIIGVGIFLATRATNIL
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagaaaacgaaaacccttcgccacatcgctatcgcggttgccctggctgttccc
cagttgacgttcgcggccctgccacaagcccaggccccgtctcgcggcgaagggacgaac
atcatccagacgctgcagaactacggctacgacggggcgatgctgcttgcgctgctgttg
ctcgcggccatgttcctgggcgtcgcggcccatgcctacggggtctaccacgagatccac
gaaggcaagaagaagtggcgcgacctcggcgcgaccgcggccgtcggcgtctgcatcatc
ggggtcggcatcttcctggcaacccgggccaccaacattctctga

DBGET integrated database retrieval system